KEGG   Ralstonia solanacearum GMI1000: RSp0732Help
Entry
RSp0732           CDS       T00071                                 

Definition
(GenBank) putative type III effector protein
Organism
rso  Ralstonia solanacearum GMI1000
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_19 TPR_14
Motif
Other DBs
NCBI-ProteinID: CAD17883
UniProt: Q8XRU9
Position
megaplasmid:919454..921946
Genome map
AA seq 830 aa AA seqDB search
MIPKTLPTHTAPISAPDGSPPEAGEQASPRRSSDVQAPRTASPDLRILADKGHGGRVGRS
LSDIGAQSMLRRHATLPRSASQGGMAPMSVPDVPDVPDVAASGVSLSGGVGSADSTGSVA
QGPAPTGSARRSELLGDYQAAIHRPLDLQRALTAIQLRSAAEIYCEKKNNLARFMPRLPR
LPASERHFQALLDKPVDDLIADVQKHPHRYSRTQLTDLAQHHLLAALNIDVKQYREGIHK
AALYEGLHSVAGRVVSAAASGISIGVSELPGVKHATSAVVKGIKKGVKILSHELPPNVIN
PALTGSLRSITDVKEAFKRVGGLPVVAPQIDQSHDMGRIVQSAKEKRRQLDEAIAHFRSA
HRTDPQALGRLVDAFLALHNVADRQYRRRIGLNRTQTYSKGWGMAVNGVAATGAVVTATV
PVVGQIAGPAIIGATIPLQWGAGYLDERRSKHRYNLRANTKWGDFLKENAAHIHFMDLKP
KHVSEPALRRSFMTQPEVQIAAIREVYEDGLGELMRQHAELGNKIAEQENKIDAQRRTGR
PARALVPQREQLRELEQRRGDLEHRINEAKQHAGHFESFDIERWHSIPADSLIGRCLDDL
NQLEKANRHARLRKPGEGAQIVQRYVQAFHGGLSTGTALPIVDAITSIDAFYTHDAQGNT
GALQPAPEVAAVGAGVVGGTVFTAATGEVRMSKAYNKKLMSELRVSPETYAAHQDQWVFR
ADNRSVDLRTTAGYRQHVHSKRDELALVGQALKHGLTSGPVGLKNLLLAKGELRHARASL
RSALNALVEARLPRTETAGKRAPTISAMKDALYDYPAVRQHLGVDAEAVG
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgaaaacactccccacccatacggccccgatctccgcgccggatggatcgccg
cccgaggccggcgagcaggcttcgccccgccgcagcagcgatgtgcaggcgccacggacc
gccagccccgacctgcggatcctggccgataaaggccatggtggccgtgtcggccgctcg
ctgtccgatatcggcgcgcaaagcatgctccgccgccatgccacgttgccgcgcagcgct
tcgcagggaggcatggcgcccatgtcggtgccggatgtaccggatgtaccggacgtggct
gcgtccggcgtgtccttgtccggcggcgtgggcagcgcggacagtacgggcagcgtggcg
cagggcccggcgcccaccggcagcgcccggcggtcggaactgctgggcgattatcaggcg
gccatccaccggccgctggaccttcagcgcgcgctcacggccatccagctgcgtagcgcg
gccgagatctattgcgagaagaaaaacaacctggcgcggttcatgccaaggttgccgcgc
ctgccggccagcgagcggcactttcaggccctgctcgacaagccggtcgacgacctgatc
gccgacgtgcaaaagcacccgcaccgctacagccgcacccagttgaccgacctcgcgcag
caccacttgcttgccgcgctgaatatcgacgtcaagcaataccgcgagggcatccacaag
gccgccctgtacgagggcctgcacagcgtggccggccgcgtcgtgagcgcagccgccagc
ggcatcagcatcggggtgtcggagctccccggcgtgaagcacgcgacgtcggccgtggtg
aaggggatcaagaagggggtcaagatcctgtcgcacgaactgccgccgaacgtcatcaac
cccgccctgaccggcagcctgcgctcgatcaccgacgtcaaggaggcgttcaagcgcgtc
ggcgggctgcccgtggtcgcgccgcagatcgaccagagccacgacatgggccgcatcgtg
caatcggcgaaggaaaagcgccggcagctcgatgaggccatcgcccatttcaggagcgcc
caccgcaccgacccgcaggcgctggggcgtctggtggacgccttcctggcgctgcacaac
gtcgccgatcgccagtatcgccgccgcatcggcctgaaccgcacgcagacctacagcaag
ggctggggcatggcggtcaacggcgtggcggccacgggcgcggtcgtcacggcaacggtt
ccggtggtcgggcagatcgccgggccggcgatcatcggtgccaccatcccgctgcaatgg
ggggcgggctacctcgacgagcggcgctccaagcaccggtacaacctgcgcgccaacacc
aagtggggggatttcctcaaggagaatgcggcgcacatccatttcatggacctgaagccg
aaacatgtgtccgagcccgcgctgcggcgctcgttcatgacgcagcccgaggtacagatc
gcggccatccgggaggtctatgaggatgggcttggcgaactgatgcgccagcacgccgag
cttgggaacaagatcgctgagcaggagaacaagatcgacgcgcagcggcgcacgggcagg
cccgcgcgcgcactcgtgccgcagcgcgagcaactgcgggagctggagcaacggcggggg
gatctggagcatcggatcaacgaggcgaagcagcatgccggccatttcgagtcgtttgac
atcgagcgctggcacagcatccctgcagacagcctgatcgggcggtgcctggatgacctg
aaccagctcgaaaaggccaaccgccatgcacgccttcgcaaaccgggcgagggcgcgcag
atcgtgcagcgctacgtccaggcattccacggcggcctatcgaccgggacggccttgccg
atcgtcgacgcgatcacctccatcgatgcgttctacacgcacgatgcgcagggcaacacc
ggcgcgttacagccggcaccggaggtggccgcggtaggcgccggcgtggtgggcggcacg
gtcttcaccgcggccacgggcgaggtccgcatgagcaaggcctacaacaagaagctgatg
tcggaactgcgggtcagccccgaaacctacgcggcgcaccaggaccagtgggtcttccgc
gccgacaaccgcagcgttgacctgcgcaccacggctggctatcgccagcacgtccattcc
aagcgggacgaactggcactggtcggccaggccctgaagcacggcctgaccagtgggccg
gttggcttgaagaacctgctccttgccaagggggagctgcgtcacgccagggcgagcctg
cgctccgcgctcaatgccctggtcgaggcgcgcctgccgcgcacggagacggccggcaag
cgtgcgcccacgatctcggctatgaaagatgcgctctacgattacccggcggtgcggcag
catttgggcgttgatgctgaggcggtggggtga

DBGET integrated database retrieval system