KEGG   Ralstonia solanacearum GMI1000: RSp0945Help
Entry
RSp0945           CDS       T00071                                 

Definition
(GenBank) probable dehydrogenase oxidoreductase protein
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00030  Pentose phosphate pathway
rso00260  Glycine, serine and threonine metabolism
rso00620  Pyruvate metabolism
rso00630  Glyoxylate and dicarboxylate metabolism
rso01100  Metabolic pathways
rso01110  Biosynthesis of secondary metabolites
rso01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RSp0945
   00620 Pyruvate metabolism
    RSp0945
   00630 Glyoxylate and dicarboxylate metabolism
    RSp0945
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSp0945
Enzymes [BR:rso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     RSp0945
    1.1.1.81  hydroxypyruvate reductase
     RSp0945
    1.1.1.215  gluconate 2-dehydrogenase
     RSp0945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh F420_oxidored NAD_binding_2 Gp_dh_N Sacchrp_dh_NADP TrkA_N
Motif
Other DBs
NCBI-ProteinID: CAD18096
UniProt: Q8XRB3
Position
megaplasmid:1191286..1192281
Genome map
AA seq 331 aa AA seqDB search
MRPSVLVTRATFPDIANRLREHFDVTDNPSDAILSPSELIARLQGKQGVMSTGSERIDAA
LLDACPQLKAVCNVGVGYNNIDVAACTARGVVVSNTPDVLTQTTADFGFALMLATARRIT
ESERFVRRGEWQKTGIHDQMLGSDIYGATLGILGMGRIGQAIARRAALGFEMQVIYHNRS
PLEAETEARAHARYVDKDTLLRESDHLILVLPYSPEAHHTIGAAELARMKPTATLTNIAR
GGIVDDAALAQALRQGTIAAAGLDVFEGEPRIHPDLLALDNIVLTPHIGSASVNTRRAMA
ALTVDNLIAALGYGPRAGQPPTPVNPQVLQQ
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccttccgtcctcgtcacccgggcgacgtttcccgacattgccaaccgcctgcgc
gaacactttgacgtgacggacaacccgtccgacgcgatcctgagcccgtcggagctgatc
gcacggctgcaaggcaagcagggcgtgatgagcaccggcagcgagcgcatcgacgcggcc
ctgctcgatgcatgcccccaactcaaggccgtgtgcaatgtgggcgtgggctacaacaac
atcgacgtggccgcctgcacggcccgcggcgtggtcgtgagcaacacgcccgacgtgctc
acccagaccaccgccgacttcggctttgcgctgatgctcgccaccgcgcggcgcatcacc
gaatccgaacgcttcgtccggcgcggcgaatggcagaagacggggatccacgaccagatg
ctcggcagcgacatctacggcgccacgctgggcatcctcggcatggggcggatcggccaa
gccatcgcccgacgtgccgcgttggggttcgagatgcaggtcatctaccacaaccgctcg
ccgctcgaggccgaaaccgaagccagggcgcatgcccgctatgtcgacaaggacaccctg
ctgcgggaatccgaccacctcatcctggtgctgccctactcccccgaggcccatcacacg
atcggcgccgccgaactggccaggatgaagccgaccgccacactgaccaacatcgctcgc
ggcggcatcgtcgacgacgcagcgttggcacaggcactgcgccagggcacgatcgcggcg
gccgggctcgacgtcttcgagggcgaaccgcgcattcaccccgacctgctggccctcgac
aatatcgtgctgacgccgcacatcggcagcgcgtcggtcaacacgcgccgcgccatggcc
gcactgaccgtcgacaacctgatcgccgcgctcggctacgggccgcgggccggccaaccg
ccgacgcccgtgaatccgcaggtgctgcagcaatag

DBGET integrated database retrieval system