KEGG   Ralstonia solanacearum GMI1000: RSp1559Help
Entry
RSp1559           CDS       T00071                                 

Gene name
zwf
Definition
(GenBank) probable glucose-6-phosphate 1-dehydrogenase oxidoreductase protein
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00030  Pentose phosphate pathway
rso00480  Glutathione metabolism
rso01100  Metabolic pathways
rso01110  Biosynthesis of secondary metabolites
rso01120  Microbial metabolism in diverse environments
rso01130  Biosynthesis of antibiotics
rso01200  Carbon metabolism
Module
rso_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:rso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RSp1559 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RSp1559 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rso04147]
    RSp1559 (zwf)
Enzymes [BR:rso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     RSp1559 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     RSp1559 (zwf)
Exosome [BR:rso04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   RSp1559 (zwf)
  Exosomal proteins of colorectal cancer cells
   RSp1559 (zwf)
  Exosomal proteins of bladder cancer cells
   RSp1559 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: CAD18710
UniProt: Q8XPS9
Position
megaplasmid:complement(1960584..1962053)
Genome map
AA seq 489 aa AA seqDB search
MSVPAFDMVLFGGTGDLARRKLIPALFDAHQGGELHSRGRIFAIGTQPLETAGYLALLER
EVRPTMRLYSGAPVSDDAWASFVARIVYQQVDARKPEQFDALAAALGENRAPVTVCYLAT
APGIFVDICAQLARVGLNTPNVRLVLEKPLGTDLASNERINSAVAEFFAEDQIYRIDHYL
GKESVQNLMAIRFGNALFEPLWRREWIKDVQITIAEQLGVEKRGDFYDGVGALRDMVQNH
LLQLVCIVAMEPPASLSQDAIRDEKLKILKALKPIPLQEVPEKTVRGQYLEGAIAGQPVQ
GYLDEHGIPHDSRTETFVAIKAEIANWRWAGVPFYLRTGKRMPQRLAEIVVRFHDVPHAL
FPKPLVQFPENRLVIRLQPEESIRLQFLTKTPGAALGLQPSTLDLDFTNHGGVRHAGAYE
RLLMDAVNGQLGLFVRRDEQAEAWRWVEPIIEAWNQARTPPKGYTAGSWGPAASSALLSR
DAAAWHEEM
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgcccgcattcgacatggtgttgtttggcggtacgggtgatctggcccgccgc
aagctgattccggccttgttcgatgcgcaccaggggggcgagctccattcgcgcgggcgg
atctttgccatcggcacccagccgctggagaccgccggttacctggccctgctcgagcgg
gaggtgcgccccaccatgcgcctgtattccggcgcgcccgtgtcggacgatgcctgggcc
tctttcgtcgcccgcatcgtctaccagcaggtcgatgcccgcaagccggaacagttcgat
gccctggccgccgcgctgggcgagaaccgcgccccggtcaccgtgtgctacctggccacc
gcgcccggcattttcgtcgacatctgcgcgcagcttgcccgcgtcggcctgaacacgccc
aacgtgcggttggtgctcgagaagccgctgggcaccgacctggcctccaacgagcgcatc
aattcggccgtggccgagttctttgccgaagaccagatctaccggatcgaccactacctc
ggcaaggagtcggtgcagaacctgatggcgatccgcttcggcaacgcgctgttcgagccg
ctgtggcgccgcgagtggatcaaggacgtgcagatcaccatcgccgagcagctcggcgtg
gagaagcgcggcgacttctacgacggcgtcggcgccctgcgcgatatggtgcagaaccac
ctgctgcagctggtgtgcatcgtcgccatggagccgcccgccagcctgtcgcaggacgcc
atccgtgacgagaagctgaagatcctcaaggcgctcaagccgatcccgctgcaggaggtg
cccgagaagaccgtgcgcggccagtatctggagggcgccatcgccgggcagccggtgcag
ggctacctggacgagcacggcattccgcatgacagccgcaccgagaccttcgtcgccatc
aaggccgagatcgccaactggcgctgggccggcgtgccgttctacctgcgcaccggcaag
cgcatgccgcagcggctggcggagatcgtggtgcgttttcatgacgtgccgcacgcgctg
tttcccaagccgctggtccagttccccgagaaccgcctggtgatccgcctgcagccggag
gaaagcatccgcctgcagttcctgaccaaaacgccgggcgcggcactgggcctgcagccg
tccacgctggacctggatttcaccaaccacggcggcgtgcgccacgccggcgcctacgag
cgcctgctgatggacgccgtcaacggccagcttggcctgttcgtgcgccgcgacgagcag
gccgaggcctggcgctgggtcgagcccatcatcgaggcatggaaccaggcccgcacgccg
cccaagggctacacggcgggcagctgggggccggccgcttccagcgcgctgctctcacgc
gatgccgctgcctggcacgaggagatgtga

DBGET integrated database retrieval system