KEGG   Rhodobacter sphaeroides 2.4.1: RSP_0160Help
Entry
RSP_0160          CDS       T00284                                 

Definition
(RefSeq) NAD-dependent epimerase/dehydratase family protein
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00520  Amino sugar and nucleotide sugar metabolism
rsp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RSP_0160
Enzymes [BR:rsp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     RSP_0160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind 3Beta_HSD NAD_binding_4 adh_short NAD_binding_10 Polysacc_synt_2
Motif
Other DBs
NCBI-GeneID: 3719545
NCBI-ProteinID: YP_353234
UniProt: Q3J1K1
Position
1:complement(1875760..1876797)
Genome map
AA seq 345 aa AA seqDB search
MDGSLIPVDVTGHDSFMPRFHRRKVILVTGGAGFVGSHLCERLIAEGHSVVCLDNLLTGR
KENVAGLLDHPQFRFLEQDILNRIDWQGPLDEIYNLACAASPPLYQRDPIHTFRTCTEGV
LNLLALARATGARILQASTSEVYGDPEISPQHEGYRGCVNTVGPRACYDEGKRAAETLFW
EFGAHQGLEVRIARIFNTYGPRMSPEDGRVVSNFIVQALTRSDITLYGDGMQTRSFCYVD
DLVAGLMALMASEVSEPVNLGNPGEFTMRELAEMVLTQTGSSSRLVHRPLPVDDPRQRRP
DIAQAARLLGWAPTVPLAEGIARTIRHFAGEPQVVRAREALLVHA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggacggaagccttattccggtcgatgtgaccggtcatgattcttttatgcctcgtttc
catcgccggaaggtcattctcgtcacgggaggagccggttttgttggctctcatctttgc
gagcggctgattgccgagggccattccgtcgtctgtctcgataatcttctgaccggccgc
aaagagaatgtcgctgggctgctcgatcatccccaattccgctttctcgagcaggacatc
ctgaaccggatcgactggcaggggccgctggacgagatctacaaccttgcctgcgcggcc
tctccgccgctctaccagcgcgatccgatccatacgttccgcacctgcaccgagggcgtg
ctgaacctgctcgcgctggcgcgggccacgggcgcgcgcatcctccaggcctcgacctcc
gaggtctatggcgatcccgagatctcgccccagcacgagggctaccgcggctgcgtcaat
acggtgggcccgcgggcctgctacgacgagggcaaacgcgcggccgagaccctgttctgg
gagttcggcgcccatcagggcctcgaggtgcggatcgcgcggatcttcaacacctacggg
ccgcggatgagccccgaggacggccgggtcgtgtcgaacttcatcgtccaggcgctgacc
cgcagcgacatcaccctctatggcgacgggatgcagacgcgctccttctgctatgtggac
gatctggtggccggactgatggcgctgatggcgtcggaggtgagcgagccggtcaacctc
ggcaatccgggcgagttcaccatgcgcgagctggccgagatggtgctgactcagaccggc
tcttcctcgcggctggtccatcggccgctgccggtcgacgatccgcgccagcgccggccc
gacatcgcgcaggcggcgcggctcctcggctgggcgccgacggtgccgctggccgaaggc
atcgcccggaccatccggcatttcgcgggcgaacctcaggtcgtccgggcgcgcgaggct
ctgctggtccatgcctga

DBGET integrated database retrieval system