KEGG   Rhodobacter sphaeroides 2.4.1: RSP_0296Help
Entry
RSP_0296          CDS       T00284                                 

Gene name
cycA
Definition
(RefSeq) Cytochrome c2
  KO
K08738  cytochrome c
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RSP_0296 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Fer2_4 YebG DUF1358 Cytochrome_CBB3
Motif
Other DBs
NCBI-GeneID: 3719209
NCBI-ProteinID: YP_353371
UniProt: Q3J164
Structure
PDB: 

Position
1:2025370..2025807
Genome map
AA seq 145 aa AA seqDB search
MKFQVKALAAIAAFAALPALAQEGDPEAGAKAFNQCQTCHVIVDDSGTTIAGRNAKTGPN
LYGVVGRTAGTQADFKGYGEGMKEAGAKGLAWDEEHFVQYVQDPTKFLKEYTGDAKAKGK
MTFKLKKEADAHNIWAYLQQVAVRP
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaagttccaagtcaaggccctcgccgccatcgccgcattcgcggcgctgccggcgctc
gcgcaggaaggcgacccggaagccggggccaaggccttcaaccagtgccagacctgccac
gtcatcgtggacgattccggcaccaccatcgccggccgcaacgccaagaccggcccgaac
ctctacggcgtcgtgggccgcaccgcgggcacgcaggccgacttcaagggctatggcgaa
ggcatgaaggaagccggcgcgaaagggctcgcctgggatgaagagcatttcgtccagtat
gttcaggatccgaccaagttcctgaaggaatataccggcgacgcgaaagccaagggcaag
atgaccttcaagctgaagaaggaagcggacgcccacaacatctgggcctacctccagcag
gtcgccgtccggccctga

DBGET integrated database retrieval system