KEGG   Rhodobacter sphaeroides 2.4.1: RSP_0296
Entry
RSP_0296          CDS       T00284                                 

Gene name
cycA
Definition
(GenBank) Cytochrome c2
  KO
K08738  cytochrome c
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RSP_0296 (cycA)
SSDB
Motif
Pfam: Cytochrom_C Fer2_4 YebG DUF1358
Other DBs
NCBI-ProteinID: ABA79470
UniProt: Q3J164
Structure
PDB: 
1CXC 2CXB 1CXA 1L9B 1L9J

Position
1:2025370..2025807
AA seq 145 aa
MKFQVKALAAIAAFAALPALAQEGDPEAGAKAFNQCQTCHVIVDDSGTTIAGRNAKTGPN
LYGVVGRTAGTQADFKGYGEGMKEAGAKGLAWDEEHFVQYVQDPTKFLKEYTGDAKAKGK
MTFKLKKEADAHNIWAYLQQVAVRP
NT seq 438 nt   +upstreamnt  +downstreamnt
atgaagttccaagtcaaggccctcgccgccatcgccgcattcgcggcgctgccggcgctc
gcgcaggaaggcgacccggaagccggggccaaggccttcaaccagtgccagacctgccac
gtcatcgtggacgattccggcaccaccatcgccggccgcaacgccaagaccggcccgaac
ctctacggcgtcgtgggccgcaccgcgggcacgcaggccgacttcaagggctatggcgaa
ggcatgaaggaagccggcgcgaaagggctcgcctgggatgaagagcatttcgtccagtat
gttcaggatccgaccaagttcctgaaggaatataccggcgacgcgaaagccaagggcaag
atgaccttcaagctgaagaaggaagcggacgcccacaacatctgggcctacctccagcag
gtcgccgtccggccctga

DBGET integrated database retrieval system