KEGG   Rhodobacter sphaeroides 2.4.1: RSP_0684Help
Entry
RSP_0684          CDS       T00284                                 

Definition
(RefSeq) putative oxidoreductase; Short-chain dehydrogenase/reductase SDR
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    RSP_0684
Enzymes [BR:rsp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     RSP_0684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase YjeF_N GDP_Man_Dehyd TrkA_N
Motif
Other DBs
NCBI-GeneID: 3718334
NCBI-ProteinID: YP_353761
UniProt: Q3J024
Position
1:complement(2427519..2428328)
Genome map
AA seq 269 aa AA seqDB search
MSLIISGKTAIVTGAAAGIGLAVARHFVDKGANVMFVDMDEERLADQIGEEARAEGPVRM
FAGDLREKLTITNLLSATMDAFDRVDILVNASRQVALSDPLCPEEDAVETLLQQNMLTSL
RLTQLTAKRMIARAEKSDEKPTQVGSIINLSSIAAIRTQPELLAYSISCAAVEQMTRSMA
VALASKGIRVNAVSFGSVMSASLQTALKDSPAMRAQITERTPMKRIASPAEIVETVQFLA
SDAAAFMTGQVVTLDGGRSLIDPALAPVH
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcatcatttccggcaagacggccatcgtgaccggggccgccgccggcatcggc
ctcgcggtggcgcggcacttcgtcgacaagggcgcgaacgtgatgttcgtggacatggac
gaggaacggctcgccgaccagatcggcgaggaggcgcgggccgagggcccggtgcgcatg
ttcgcgggcgacctgcgcgagaagctgacgatcaccaacctcctgtcggccacgatggat
gccttcgaccgggtcgacatcctcgtgaatgcgagtcgtcaggtggctctgtccgatccg
ctctgcccggaagaggatgcggtcgagacgcttctgcagcagaatatgctgaccagcctg
cgcctcacccagctgacggccaagcggatgatcgcgcgggccgagaagagcgacgagaag
cccacgcaggtgggctcgatcatcaacctctcctccatcgccgcgatccgcacccagccc
gagcttctggcctattcgatcagctgcgccgcggtcgagcagatgacgcggtcgatggcg
gtggcgctggcctcgaagggcatccgggtgaatgcggtctccttcggctcggtcatgagc
gcgagcctccagaccgcgctgaaggacagcccggcgatgcgcgcccagatcaccgagcgc
acgccgatgaagcgcatcgcctcgccggccgagatcgtcgagacggtgcagttcctcgcc
tcggacgcggcggccttcatgacgggacaggtggtgacgctcgacggcggacgcagcctg
atcgacccggccttggcgccggtgcactga

DBGET integrated database retrieval system