KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1595Help
Entry
RSP_1595          CDS       T00284                                 

Definition
(RefSeq) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00240  Pyrimidine metabolism
rsp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RSP_1595
Enzymes [BR:rsp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     RSP_1595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-GeneID: 3718585
NCBI-ProteinID: YP_351640
UniProt: Q3J645
Position
1:189713..191020
Genome map
AA seq 435 aa AA seqDB search
MDARSINAKLRRGEVPSAAELGWFAEGLASGHVTDAQAGAFAMAVCLQGLGEEGRVALTR
AMRDSGRVLAWDLPGPVLDKHSTGGIGDCTSLLLAPALAACGAYVPMISGRGLGHTGGTL
DKLEAIPGFRVALGEERLRAQIEDVRCAIVAADEGMAPADRRLYLIRDVTGTVESIDLIT
ASILSKKLAAGLEGLVLDVKVGSGAFMKSMDEAEALARALVGTAQGAGCMTSALITDMSQ
PLATAAGNALEVIEVMETLTGTSINAALWDVTVALGGEALALGGLAADAEDGAHRIEQAL
ESGHAAEFFARMVAAQGGPVDFVERWPDRLPSAPVMREVPSLRTGFVLRIDTAALGQAVV
HLGGGRLRETDRVNPSVGLADIAGIGEEVSEDLPLAMIHAATEADADAAVAAIQAAYVIS
DQEPAEPPLIHARIA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtggacgcgcgatcgatcaacgcaaagctgcgccggggcgaagtgccctcggccgctgaa
ctgggctggttcgcggaaggtctggcctcggggcatgtcaccgatgcgcaggccggcgcc
ttcgccatggcggtctgcctgcagggtctgggcgaggaggggcgtgtggccctgacgcgc
gccatgcgcgactccggccgggtgctcgcctgggacctgccggggccggtgctcgacaaa
cattcgacgggcggcatcggagactgcacctcgctgctcctcgcgccggctctggctgcc
tgcggggcctatgtgccgatgatctcgggtcggggcctcggccatacggggggcacgctc
gacaagctggaagcgatccccggcttccgcgtggccctgggcgaagagcggttgcgcgcg
cagatcgaggatgtccgctgcgccatcgtcgccgccgacgagggcatggcgcccgcggac
cggcggctctacctcatccgcgacgtgaccggcacggtcgaatcgatcgacctcatcacc
gcgtcgatcctgtcgaagaagctggcggccgggctcgaggggctggtgctcgatgtgaaa
gtgggttcgggcgccttcatgaagtcgatggacgaggccgaggcgctggcgcgtgcgctg
gtgggcacggcgcagggggcgggctgcatgacatcggccctcatcaccgacatgagccag
ccgctcgcgaccgcggccggcaatgcgctcgaggtgatcgaggtgatggagacgctgacc
ggcacctcgatcaatgccgcgctctgggacgtgacggtggcgctcggcggcgaggccctg
gcgctgggcggccttgccgccgacgccgaggacggggcgcaccggatcgagcaggcgctg
gagagcgggcatgcggccgaattcttcgcccgcatggtggcggcgcagggcggcccggtc
gatttcgtcgagcgctggcccgaccggctgccctcggcccccgtgatgcgcgaggtgccg
agcctgcgcacgggcttcgtgctgcgcatcgacacggcggcgctcggtcaggcggtggtg
catctgggtggcgggcggctgcgcgagaccgaccgggtgaatccctcggtgggtctggcc
gatatcgccgggatcggcgaggaagtgtccgaggatctgccgctcgccatgatccatgcc
gcgaccgaggccgatgccgatgctgcggtggccgcgattcaggcggcctatgtgatctcg
gatcaggaaccggccgagccgccgctcatccatgcgaggatcgcctga

DBGET integrated database retrieval system