KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1771Help
Entry
RSP_1771          CDS       T00284                                 

Definition
(RefSeq) beta-methylmalyl-CoA/L-malyl-CoA lyase
  KO
K08691  malyl-CoA/(S)-citramalyl-CoA lyase [EC:4.1.3.24 4.1.3.25]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00630  Glyoxylate and dicarboxylate metabolism
rsp00660  C5-Branched dibasic acid metabolism
rsp00680  Methane metabolism
rsp01100  Metabolic pathways
rsp01120  Microbial metabolism in diverse environments
rsp01200  Carbon metabolism
Module
rsp_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RSP_1771
   00660 C5-Branched dibasic acid metabolism
    RSP_1771
  09102 Energy metabolism
   00680 Methane metabolism
    RSP_1771
Enzymes [BR:rsp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     RSP_1771
    4.1.3.25  (S)-citramalyl-CoA lyase
     RSP_1771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI C-C_Bond_Lyase
Motif
Other DBs
NCBI-GeneID: 3718977
NCBI-ProteinID: YP_351819
UniProt: Q3J5L6
Structure
PDB: 

Position
1:354739..355695
Genome map
AA seq 318 aa AA seqDB search
MSFRLQPAPPARPNRCQLFGPGSRPALFEKMAASAADVINLDLEDSVAPDDKAQARANII
EAINGLDWGRKYLSVRINGLDTPFWYRDVVDLLEQAGDRLDQIMIPKVGCAADVYAVDAL
VTAIERAKGRTKPLSFEVIIESAAGIAHVEEIAASSPRLQAMSLGAADFAASMGMQTTGI
GGTQENYYMLHDGQKHWSDPWHWAQAAIVAACRTHGILPVDGPFGDFSDDEGFRAQARRS
ATLGMVGKWAIHPKQVALANEVFTPSETAVTEAREILAAMDAAKARGEGATVYKGRLVDI
ASIKQAEVIVRQAEMISA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagcttccgccttcagcccgcgccgcctgcccgtccgaaccgctgccagctgttcggc
cccggctcccggcccgcgctgttcgagaagatggcggcctccgcagcagacgtgatcaac
ctcgacctcgaggattcggtggcgcccgacgacaaggcgcaggcccgcgcgaacatcatc
gaggcgatcaacgggctcgactggggccgcaagtatctctcggtccgcatcaacggtctg
gacacgcccttctggtatcgcgacgtcgtggacctgctcgaacaggccggcgaccggctc
gaccagatcatgatcccgaaggtcggctgcgcggcggatgtctatgcggtcgatgctctg
gtcacggccatcgagcgcgccaagggccgcaccaagcccctgagcttcgaggtcatcatc
gaatcggccgcgggcatcgcccatgtcgaggaaatcgcggcctcctcgccgcgcctgcag
gccatgagcctcggcgccgccgatttcgcagcctcgatggggatgcagacgacaggtatc
ggtggcacgcaggaaaactactacatgttgcatgacgggcagaagcactggtcggacccg
tggcactgggcgcaggcggccatcgtggcggcctgccggacccacgggatcctgcccgtg
gacggcccgttcggcgatttttccgacgatgagggcttccgcgcgcaggcccgccgctcg
gccactctgggcatggtgggcaaatgggccatacatcccaaacaggtggcccttgcgaac
gaagttttcaccccttccgagacggccgtgaccgaagcgcgcgagatcctcgcggcgatg
gatgcggccaaggcgaggggcgagggcgccacggtctacaagggaagacttgttgacatc
gcgtccatcaaacaggcagaagtgatcgtaaggcaggcagaaatgatctcggcctga

DBGET integrated database retrieval system