KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1799
Entry
RSP_1799          CDS       T00284                                 

Gene name
secF
Definition
(GenBank) protein translocase subunit secF
  KO
K03074  preprotein translocase subunit SecF
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp03060  Protein export
rsp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    RSP_1799 (secF)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RSP_1799 (secF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rsp02044]
    RSP_1799 (secF)
Secretion system [BR:rsp02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   RSP_1799 (secF)
SSDB
Motif
Pfam: SecD_SecF Sec_GG DUF5693 DUF3995
Other DBs
NCBI-ProteinID: ABA77946
UniProt: O33568
Position
1:385061..386035
AA seq 324 aa
MAFRLKLCPEKTNIDFFWAAPVTFGFSVFLMAASLVAWLTLGLNFGIDFRGGTTIRTEST
QAVDVAAYRAALEGQDLGDISITEVFDPGFRADQHVAMVRIGAQDATQSITPEQIGQVEE
ALKTVDPSITFPSVESVGPKVSGELIRSAILAVAAACAGIAVYIWLRFEWQFALGSVAAL
IHDVLVTIGVFALFQIKFDLTTVAALLTVLGYSINDTVVVFDRLRENLVKYKTMPLRDVM
NLSVNETLSRTIMTLMTTLIALVSLLVFGGDVIRGFVFAITFGVVIGTYSSVYMAKNIVL
YLGVDRGGPKKDSKAGTQFANIDA
NT seq 975 nt   +upstreamnt  +downstreamnt
atggctttccgcctcaaactctgccccgaaaagacgaacatcgacttcttctgggccgcg
ccggtcaccttcggcttctcggtcttcctgatggcggcctcgctcgtggcctggctgacg
ctggggctgaatttcgggatcgacttccgcggcggcacgacgatccggacggaatcgaca
caggccgtggatgtggccgcctatcgcgccgccctcgaggggcaggatcttggcgacatc
tcgatcaccgaggtcttcgatcccggcttccgcgcggatcagcacgtcgccatggtccgc
atcggcgcacaggacgcgacccagtcgatcacgcccgagcagatcggacaggtcgaggag
gcgctgaagaccgtcgatccgtccatcaccttcccgtccgtcgagtcggtggggccgaag
gtctcgggcgagctgatccggtcggcgatcctggcggtcgccgccgcctgcgcgggcatc
gccgtctatatctggctcaggttcgaatggcagttcgccctgggctcggtggccgcattg
atccacgacgtgctggtgacgatcggcgtcttcgcgctgttccagatcaagttcgacctg
acgacggtcgcggccctcctcaccgttctcggctattcgatcaacgacacggtggtggtg
ttcgaccggctgcgcgagaacctcgtcaagtacaagaccatgccgctccgcgacgtgatg
aacctctcggtcaacgagacgctgagccggacgatcatgacgctgatgaccacactcatc
gcgctcgtgtcgcttctcgtcttcggcggcgacgtgatccgcggcttcgtcttcgccatc
accttcggcgtggtgatcgggacctattcctcggtctacatggccaagaacatcgtgctc
tatctcggcgtggaccggggtgggccgaagaaggacagcaaggcgggcactcagttcgcc
aatatcgacgcctga

DBGET integrated database retrieval system