KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1946Help
Entry
RSP_1946          CDS       T00284                                 

Definition
(RefSeq) Cytochrome P450 hydroxylase
  KO
K00493  unspecific monooxygenase [EC:1.14.14.1]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00071  Fatty acid degradation
rsp00380  Tryptophan metabolism
rsp00627  Aminobenzoate degradation
rsp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    RSP_1946
  Amino acid metabolism
   00380 Tryptophan metabolism
    RSP_1946
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RSP_1946
Enzymes [BR:rsp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     RSP_1946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450 PP2C_2
Motif
Other DBs
NCBI-GeneID: 3719256
NCBI-ProteinID: YP_351998
UniProt: Q3J537
Position
1:complement(543675..544856)
Genome map
AA seq 393 aa AA seqDB search
MQTLSQSPHDRRFLRNPYRFYREARAAGPFFHWEELGLVCTTSYAAANAILRDRRFGREV
PPGRASAVPDHLAPFAAVEAHSMLELEPPRHTRLRNLVLRAFTSRRIGTMQPEVAALSES
LVAAVPEGPFDLLPAFSQRLPITLIARLIGIPESLAPELLRWSSAMVAMYQAGRTRKTEE
RAALAAADFSDFLRLHIEARRHAPADDLLTHLIAAEADGQQLSTDEIVSTCILILNAGHE
AAVHAIGNAAAVLLRHRTPPEALAPPHLLGTVEELLRFDPPLHLFRRMAYERVEIMGRTI
EEGCEVALLLGAANRDPGPWERPDRFLWNRPEKTHLAFGAGLHFCLGAPLARLELATALP
ILFGRLPNLQLVKPPSYGDSWHFRGLERLIVSA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccctgagccaatccccgcacgaccgccgcttcctgcgcaatccctaccgcttc
tatcgcgaggcacgcgcggccggacccttcttccactgggaggagctggggctcgtctgc
accacttcctacgctgccgccaacgccatcctgcgcgaccggcgcttcggccgcgaggtg
ccccccggacgggcttcagccgtccccgatcatctcgcgcccttcgcggcggtcgaggcc
cattccatgctggagctcgagccgccccgccacacgcggctgcgcaacctcgtgctgcgc
gccttcaccagccgccgcatcggcaccatgcagcccgaggtcgcggccctgtcggagagc
ctcgtggccgcggtgcccgagggcccgttcgatctgctgcccgccttcagccagcgcctg
cccatcacgctgatcgcgcggctgatcggcatccccgagtcgctggcgcccgaactgctg
cgctggtcgtcggcgatggttgccatgtatcaggcgggccgcacccgcaagacggaagag
cgcgcggcgctggccgccgccgacttctcggatttcctgcggcttcatatcgaagcccgg
cgccacgcgccggccgacgatctgctcacccatctcatcgcggccgaagccgacgggcag
cagctctcgaccgacgagatcgtctcgacctgcatcctaatcctgaacgcgggccacgag
gcggcggtccatgccatcggcaatgcggcggccgtcctgctgcgccaccgcacgccgccc
gaggcgcttgcgccgccgcatctgctgggcacggtcgaggaactgctgcgcttcgacccg
ccgctccacctgttccgtcgcatggcctacgagagggtcgagatcatggggcggaccatc
gaggagggctgcgaggtggcgctcctcctcggggcggcgaaccgcgacccgggcccctgg
gagcggccggaccgcttcctctggaaccggcccgagaagacgcatctggccttcggcgcg
gggctgcatttctgcctcggtgcgccgctcgcgcggctcgagctggcgaccgcgctgccg
atcctgttcgggcggctgcccaacctgcagctggtgaagccgccgtcctacggggacagc
tggcacttccgggggctcgagcggctgatcgtgtcggcctga

DBGET integrated database retrieval system