KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1986Help
Entry
RSP_1986          CDS       T00284                                 

Gene name
gatB
Definition
(RefSeq) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00970  Aminoacyl-tRNA biosynthesis
rsp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RSP_1986 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rsp03029]
    RSP_1986 (gatB)
Enzymes [BR:rsp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RSP_1986 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RSP_1986 (gatB)
Mitochondrial biogenesis [BR:rsp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RSP_1986 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 3719319
NCBI-ProteinID: YP_352037
UniProt: Q3J4Z8
Position
1:complement(581289..582800)
Genome map
AA seq 503 aa AA seqDB search
MLDLTYEAPKPKVIAGAKHDWELVIGMEIHAQVSSNAKLFSGASTTFGAEPNSNVSFVDC
AMPGMLPVINEFCVAQAVRTGLGLKAQINLVSAFDRKNYFYPDLPQGYQISQLYHPIVGE
GEVLVELAPGIARLVRIERIHLEQDAGKSIHDMDPNLSFVDFNRTGVALMEIVSRPDIRG
PEEAAAYVAKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFSHLGTRC
EIKNMNSMRFIQQAIDYEARRQIAILEDGGKVVQETRLYDPDKGETRSMRSKEEAHDYRY
FPDPDLLPLEIEQGWVDEIAASMPELPDAKKARFMADYGVTDYDANVLTAELDAAAYFEE
VARGRDGKQAANWVINELFGRLNKQGLTIADTPVKAGQLGGVLDLIASGEISGKMAKDLF
EILWTEGGDPAEVAAARGMKQVTDTGAIETAVDEIIAANPAQVEKAKANPKLAGWFVGQV
IKATGGKANPAAVNQIVAQKLGL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacctgacctacgaagcccccaagcccaaggtgatcgccggggccaagcacgac
tgggaactggtgatcgggatggagatccacgcccaggtctcgtcgaatgccaagctcttc
tcgggcgcctcgaccaccttcggggccgagccgaactcgaacgtctccttcgtggattgc
gcgatgccgggaatgctgccggtcatcaacgagttctgcgtggcgcaggcggtccgcacc
ggcctcggcctgaaggcgcagatcaacctcgtctcggccttcgaccgcaagaactacttc
tacccggacctgccgcagggctaccagatcagccaactctaccatccgatcgtgggcgag
ggcgaggtgctggtcgagctggccccgggcatcgcgcggctggtgcggatcgagcgcatt
cacctcgagcaggatgcgggcaagtcgatccacgacatggacccgaatctctctttcgtg
gacttcaaccgcaccggcgtcgcgctgatggaaatcgtgagccgccccgacatccgcggg
cccgaggaggcggcggcctatgtggcgaaactccgccagatcctgcgctacctcggcacc
tgcgacggcaacatgcagaacggcaacctccgcgccgacgtgaacgtgtcggtctgccgt
ccgggacagtacgagaagtatcaggagacgcaggatttctcgcatctgggcacccgttgc
gagatcaagaacatgaactcgatgcgcttcatccagcaggccatcgattacgaggcgcgc
cgccagatcgccattctcgaggatggcggcaaggtggtgcaggaaacgcggctctacgat
cccgacaagggcgagacgcgctcgatgcggtcgaaggaagaggcgcacgattaccgctac
ttccccgaccccgacctcctgccgctcgagatcgaacagggctgggtggacgagatcgcg
gcctcgatgcccgaactgccggacgcgaagaaggcccgtttcatggccgactatggcgtg
accgactacgacgccaatgtgctgacggccgaactcgatgcggcggcctatttcgaggag
gtggctcgcgggcgcgacggcaagcaggcggcgaactgggtcatcaacgagctcttcggc
cggctgaacaagcagggcctgaccatcgccgacacgccggtgaaggccggacagctgggc
ggggttctcgatctgatcgcgtcgggcgagatttccggcaagatggccaaggatctgttc
gagatcctctggaccgagggcggcgatccggcagaggtggccgcggcgcgcggcatgaag
caggtgaccgacaccggggccatcgagacggcggtcgacgagatcatcgcggccaatccc
gcgcaggtcgagaaggccaaggcgaaccccaagcttgcgggctggttcgtgggtcaggtc
atcaaggccacgggcggcaaggccaatccggccgccgtcaaccagatcgtggcccagaag
ctggggctctga

DBGET integrated database retrieval system