KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1997Help
Entry
RSP_1997          CDS       T00284                                 

Gene name
lexA
Definition
(RefSeq) LexA repressor
  KO
K01356  repressor LexA [EC:3.4.21.88]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rsp01002]
    RSP_1997 (lexA)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rsp03400]
    RSP_1997 (lexA)
Enzymes [BR:rsp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.88  repressor LexA
     RSP_1997 (lexA)
Peptidases and inhibitors [BR:rsp01002]
 Serine peptidases
  Family S24: LexA family
   RSP_1997 (lexA)
DNA repair and recombination proteins [BR:rsp03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    RSP_1997 (lexA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LexA_DNA_bind Peptidase_S24 MarR_2 HTH_IclR MarR
Motif
Other DBs
NCBI-GeneID: 3719330
NCBI-ProteinID: YP_352048
UniProt: Q9ZFA4
Position
1:complement(596007..596693)
Genome map
AA seq 228 aa AA seqDB search
MLTRKQMELLDFIKTRMDRDGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLAHR
ARAIEIVKLPEAMERAGFSARAAKAAAAPLPKGAVTVETAGALDLPLMGRIAAGLPIEAI
NGGPQSVTVPGMMLSGRGQHYALEVKGDSMIAAGINDGDIVVIREQQTADNGDIVVALVA
DHEATLKRYRRRGGMIALEPANDSYETQVYPEQMVKVQGRLVGLIRSY
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
gtgttgacgcgtaagcagatggaactgctcgatttcatcaagacgcggatggatcgtgac
ggggtgccaccctcgttcgacgagatgaaggacgcgctcgacctccgctcgaaatcgggc
attcaccggctcatcacggcgctcgaggagcgggggttcatccgcaggctggcgcaccgc
gcccgcgcgatcgagatcgtgaaactgcccgaggcgatggagcgagccggcttcagcgcc
cgggccgccaaggctgcggcggccccgctgccgaagggcgccgtgacggtcgagaccgcc
ggggcactcgatctgccgctcatgggccggatcgcggccggtctgccgatcgaggccatc
aacggcggcccgcagtcggtcaccgtacccggcatgatgctctcgggccgcggccagcat
tatgcgctggaggtgaagggggattcgatgatcgccgccggcataaacgatggcgacatc
gtggtgatccgcgagcagcagacggccgacaatggcgacatcgtggtggcgctggtggcc
gatcacgaggccacgctgaagcgctaccgccgtcgcggcggcatgatcgctctcgagccc
gccaacgactcctacgagacgcaggtctaccccgaacagatggtgaaggtgcagggacgg
ctcgtcgggctgatccgcagctactga

DBGET integrated database retrieval system