KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2334Help
Entry
RSP_2334          CDS       T00284                                 

Gene name
pfkB
Definition
(RefSeq) 6-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00010  Glycolysis / Gluconeogenesis
rsp00030  Pentose phosphate pathway
rsp00051  Fructose and mannose metabolism
rsp00052  Galactose metabolism
rsp00680  Methane metabolism
rsp01100  Metabolic pathways
rsp01110  Biosynthesis of secondary metabolites
rsp01120  Microbial metabolism in diverse environments
rsp01130  Biosynthesis of antibiotics
rsp01200  Carbon metabolism
rsp01230  Biosynthesis of amino acids
Module
rsp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSP_2334 (pfkB)
   00030 Pentose phosphate pathway
    RSP_2334 (pfkB)
   00051 Fructose and mannose metabolism
    RSP_2334 (pfkB)
   00052 Galactose metabolism
    RSP_2334 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    RSP_2334 (pfkB)
Enzymes [BR:rsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RSP_2334 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-GeneID: 3719866
NCBI-ProteinID: YP_352390
UniProt: Q3J3Z5
Position
1:complement(961655..962599)
Genome map
AA seq 314 aa AA seqDB search
MIPILTLTLNPAIDLAADVPQVLPGIKLRCTEPRVDPGGGGLNVSRAIRILGGRSTAFVA
LGGNIGGRLAALVAAAGIEIVAFSGPGETRESLTVTETATGRQFRFMLPGAAWDAERVEA
ALARIDRAVPEGGMVVLSGSLPPGVPADFPAMVSRVLGKRARLLVDTSGAPLAHLAAGGV
PDLDILRMDDGEAASLAGRPLACASETADFASSLVARGVAECVIVARGADGSVLADARGR
WHARSEPVEVVSAVGAGDTFVGAFVLALSRGAPPEEALAHGVAGAAAAVLTEATELCHPE
DVARLLPSAAATAL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgatccccattctcacgttgacgctgaacccggcgatcgacctcgctgccgacgtgccg
caggtcctgccgggcatcaagctgcgctgcaccgagccccgggtcgatccgggcggcggc
gggctgaacgtcagccgcgccatccgcatcctcggcggccggagcaccgccttcgtggcc
ctcggcggcaacatcggcgggcggctggccgccctggtcgcggcggccggcatcgagatc
gtggccttctcgggccccggcgagacgcgcgaaagcctcaccgtcaccgaaacggccacg
ggccggcagttccgcttcatgctgccgggcgccgcctgggacgcagagcgcgtcgaggcc
gctctggcccggatcgaccgcgccgtgcccgaaggcggcatggtggtgctctcgggctcg
ctgccgcccggcgtgccggccgacttcccggccatggtctcccgggtgctgggcaagcgc
gcccggcttctggtcgacacgtccggcgcgccgctcgcccatctggcggcgggcggggtg
cccgacctcgacatcctgcggatggacgatggcgaggccgcgagccttgccggccgcccc
ctcgcctgcgcctccgaaacggccgatttcgcctcaagcctcgtggcccgcggcgtggcc
gagtgcgtgatcgtcgcccgcggcgccgacggatcggtcctcgccgatgcccgcggccgc
tggcacgcccgctccgaaccggtcgaggtggtgagcgcggtgggtgcgggcgacacgttc
gtcggcgccttcgtcctcgccctctcgcggggcgccccgccggaggaggcgctggcccat
ggcgtggccggcgccgcggcggccgtcctcaccgaggcgaccgaactctgccatcccgag
gatgtggcgcgcctcctgccctccgccgccgcgacggccctctga

DBGET integrated database retrieval system