KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2565Help
Entry
RSP_2565          CDS       T00284                                 

Gene name
ugpG
Definition
(RefSeq) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00040  Pentose and glucuronate interconversions
rsp00052  Galactose metabolism
rsp00500  Starch and sucrose metabolism
rsp00520  Amino sugar and nucleotide sugar metabolism
rsp01100  Metabolic pathways
rsp01130  Biosynthesis of antibiotics
Module
rsp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RSP_2565 (ugpG)
   00052 Galactose metabolism
    RSP_2565 (ugpG)
   00500 Starch and sucrose metabolism
    RSP_2565 (ugpG)
   00520 Amino sugar and nucleotide sugar metabolism
    RSP_2565 (ugpG)
Enzymes [BR:rsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RSP_2565 (ugpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-GeneID: 3720199
NCBI-ProteinID: YP_352624
UniProt: Q3J3B1
Position
1:complement(1210491..1211429)
Genome map
AA seq 312 aa AA seqDB search
MSSQKVTTAIFPIAGMGTRFLPATKSIPKEILTLVDKPLIQYAVEEAREAGIEDFIFVTS
RGKGALEDFFDVNQTLERALRAAGKTELLATLEATNIDSGHVTYVRQHEALGLGHAVWCA
RRLVGDEPFAVILPDDMVVADKPCLAQMIEAHEEVGGSIIATMEVPAEKASSYGVLDIEE
RQGALIRPRGIVEKPKAGTAPSNMAVIGRYILGPRVMQHLDRRTVGAGGEIQLTDAIAHE
LATHPGSVHGFRFQGERFDCGSKAGFLQATVALALEREDLRGEFSTFLRAIAEQHGLGAP
SAAPLRSVAAAS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcccagaaggtcaccactgccattttccccatcgcaggcatggggacgcggttc
ctgcccgcgaccaagtcgatcccgaaggaaattctcacgctcgtcgacaagccgctgatc
cagtatgcggtcgaggaagcccgcgaggccggcatcgaggacttcatcttcgtcacctcc
cgcggcaagggggcgctcgaggacttcttcgacgtgaaccagacgctggagcgggccctg
cgcgcggcgggcaagaccgagcttctggcaacgctcgaggccaccaatatcgacagcggc
catgtgacctacgtccgccagcacgaggcgctgggcctcggccatgccgtctggtgcgcg
cgccgcctcgtgggcgacgagcccttcgcggtgatcctgcccgacgacatggtggtcgcc
gacaagccctgcctcgcgcagatgatcgaggcccatgaagaggtcggcggcagcatcatc
gccacgatggaagtgccggcggaaaaggcgtcctcctacggcgtcctcgacatcgaagag
cgtcagggcgcgctgatccgtccgcgtggcatcgtcgagaaaccgaaggccggcaccgcg
ccttcgaacatggcggtcatcggccgctatatcctcgggccgcgcgtcatgcagcatctc
gaccggcgcaccgtcggagcggggggcgagatccagctgaccgacgccatcgcgcacgag
ctggccacccatccgggctcggtccacggcttccgcttccagggcgagcggttcgactgc
ggctcgaaggcgggcttccttcaggccaccgtcgcgctggcgctggagcgcgaggatctg
cgcggggaattctcgaccttcctgcgggcgatcgccgagcagcacggtctcggagccccg
agcgccgcgccgctgcgcagcgtggcggccgcgagctga

DBGET integrated database retrieval system