KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3184Help
Entry
RSP_3184          CDS       T00284                                 

Definition
(RefSeq) putative Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00071  Fatty acid degradation
rsp00072  Synthesis and degradation of ketone bodies
rsp00280  Valine, leucine and isoleucine degradation
rsp00310  Lysine degradation
rsp00362  Benzoate degradation
rsp00380  Tryptophan metabolism
rsp00620  Pyruvate metabolism
rsp00630  Glyoxylate and dicarboxylate metabolism
rsp00640  Propanoate metabolism
rsp00650  Butanoate metabolism
rsp00900  Terpenoid backbone biosynthesis
rsp01100  Metabolic pathways
rsp01110  Biosynthesis of secondary metabolites
rsp01120  Microbial metabolism in diverse environments
rsp01130  Biosynthesis of antibiotics
rsp01200  Carbon metabolism
rsp01212  Fatty acid metabolism
rsp02020  Two-component system
Module
rsp_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RSP_3184
   00630 Glyoxylate and dicarboxylate metabolism
    RSP_3184
   00640 Propanoate metabolism
    RSP_3184
   00650 Butanoate metabolism
    RSP_3184
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RSP_3184
   00072 Synthesis and degradation of ketone bodies
    RSP_3184
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RSP_3184
   00310 Lysine degradation
    RSP_3184
   00380 Tryptophan metabolism
    RSP_3184
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RSP_3184
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RSP_3184
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RSP_3184
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rsp04147]
    RSP_3184
Enzymes [BR:rsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RSP_3184
Exosome [BR:rsp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RSP_3184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 3721475
NCBI-ProteinID: YP_354700
UniProt: Q3IXD5
Position
2:complement(235895..237055)
Genome map
AA seq 386 aa AA seqDB search
MAAEPIVIAGAARTPMGAFQGALKGRTGVELGAAAISAALARAGLAPEAVEEVVMGCVLP
AGLGQAPARQAALGAGLPLSVPCATLNKVCGSGMKAAMAAHDMIRAGSAGIVVAGGMESM
SNAPYLLDKARGGYRIGHGRVLDHMFLDGLEDAYDRGRAMGTFAEDCAEAYQFTRDAQDA
YALASLARAQAAIAEGRFAAEVVAVDGVAVDEAPGRARPEKIPQLRPAFREGGTVTAANS
SSISDGAAALVIASAGAAEAQGLTPLATIRGHASHAQAPNLFTTAPIFAIGKLLERLGWS
AAEVDLFEINEAFAVVAMAAMRDLDLPHDKVNVNGGACALGHPIGCSGARIVVTLIEALR
ARGLRRGVASLCIGGGEATALAVEVI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggaaccgatcgtgatcgcgggggcggcgcggacgccgatgggcgcctttcag
ggtgcgctcaagggccggacgggggtcgagctcggcgcggcggcgatctcggccgcgctc
gcgcgggcgggcctcgcccccgaggcggtcgaggaggtcgtgatgggctgcgtgctgccc
gcgggcctcgggcaggcgccggcgcggcaggcggctctgggcgcggggctgccgctctcg
gtgccctgcgctacgctgaacaaggtctgcggctcggggatgaaggccgccatggccgcg
catgacatgatccgggcgggcagcgcgggcatcgtcgtcgcgggcggtatggagagcatg
tcgaacgcgccctatctgctcgacaaggcgcgcggcggctaccggatcgggcatgggcgc
gtgctggaccacatgttcctcgacgggctcgaggatgcctacgaccgcggccgcgccatg
ggcaccttcgccgaggattgcgccgaggcctaccagttcacccgcgacgcgcaggatgcc
tatgcgctggcctcgctggcccgggcgcaggcggccattgccgaggggcgcttcgcggcc
gaggtggtggcagtggacggggtggcggttgacgaggccccgggccgcgcccgccccgag
aagatcccccagctcaggcccgccttccgcgagggcggcacggtgacggcggccaacagc
tcctcgatctcggacggggcggcggcgctcgtgatcgcctcggccggcgcggccgaggcg
caggggctgaccccgctcgccacgatccgcggccatgcaagccatgcgcaggcgccgaac
ctttttaccacggcgccgatcttcgccatcgggaagcttctcgagcggttgggctggagc
gcggccgaggtcgatctcttcgagatcaacgaggctttcgcagtggtggccatggccgcg
atgcgcgacctagacctgccccacgacaaggtcaatgtgaacggcggcgcctgcgcgctc
ggccatccgatcggctgctcgggggcgcggatcgtggtgactttgatcgaggcgctgcgg
gcgcggggattgagacgcggcgtggcctcgctctgcatcggcggcggcgaggcgacggcg
ctggcggtggaggtgatctga

DBGET integrated database retrieval system