KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3242Help
Entry
RSP_3242          CDS       T00284                                 

Definition
(RefSeq) Putative trypsin-like serine protease
  KO
K04771  serine protease Do [EC:3.4.21.107]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp01503  Cationic antimicrobial peptide (CAMP) resistance
rsp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RSP_3242
 09160 Human Diseases
  09168 Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    RSP_3242
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rsp01002]
    RSP_3242
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rsp03110]
    RSP_3242
Enzymes [BR:rsp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.107  peptidase Do
     RSP_3242
Peptidases [BR:rsp01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   RSP_3242
Chaperones and folding catalysts [BR:rsp03110]
 Other chaperones and cochaperones
  DegP / HtrA
   RSP_3242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin_2 PDZ_2 PDZ Trypsin Tricorn_PDZ Peptidase_S46 PDZ_1 Peptidase_S29
Motif
Other DBs
NCBI-GeneID: 3721847
NCBI-ProteinID: YP_354755
UniProt: Q3IX80
Position
2:299481..300932
Genome map
AA seq 483 aa AA seqDB search
MPMPTPRSSLKAVLIASTLITAGVAGTALPPTAARAEVPMQGYADLVARVSPAVVFIEVT
AKSKESTPMAGSPFEEFLRRFGEIDPQFRMPQAPEGGQVMHGLGSGFLISQDGIIVTNNH
VVENATDMKVKLEDGREFKAEVVGTDPMTDIAVIRLKDAKDLPFVELGDSEKLRVGDAVV
AVGNPFGLGGTVTSGIVSAMGRNINSGPYDDYIQTDAAINRGNSGGPLFDTEGKVVGMNT
AIFSPSGGSVGIGFSIPANTVKDVVAQLQDKGSVSRGWLGVTVQGMTPEIAQAMGLEGRD
GALVAEVQQGSPADEGGLESGDVITAVNGQELTERASLPRLIAAIPNGEKAQLTVQRDGR
QQEMTVTIGELTPDRAQVASAESPEGLGGPLGIEVQPLEPALARQLGLPDGASGVVVTAV
DPSGPNADRLAPGDVIQEAAGHPIETPRDLASAMREARGKGVMLMKVLRQGNPVYVGAEV
ASS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgcccaccccgcgttcctcgctgaaggccgtcctgatcgccagcaccctcatc
accgccggtgtcgccggcacggccctgccgccgaccgcggcccgggccgaggtgccgatg
cagggctatgccgatctcgtcgcccgcgtctcgcccgccgtcgtcttcatcgaggtgacg
gccaagtcgaaggagtccacgccgatggcgggctctcccttcgaggaattcctccgccgc
ttcggcgagatcgacccgcagttccgcatgccgcaggcccccgagggcgggcaggtcatg
cacgggctcgggtcgggcttcctgatctcgcaggacggcatcatcgtcaccaacaaccat
gtggtcgaaaatgcgaccgacatgaaggtcaagctcgaggacggccgcgagttcaaggcc
gaagtcgtgggcaccgatccgatgaccgacatcgcggtgatccggctgaaggatgccaag
gacctgcccttcgtcgagcttggcgacagcgagaagctgcgcgtgggggatgcggtggtg
gccgtcggcaacccgttcgggctgggcggcaccgtgacctcgggcatcgtctcggccatg
gggcgcaacatcaactcgggcccctacgacgactacatccagaccgacgcggccatcaac
cgcggcaactcgggcggcccgctgttcgacaccgagggcaaggtcgtcggcatgaacacc
gcgatcttctcgccctccggcggctcggtgggcatcggcttctcgatccccgcgaacacg
gtcaaggatgtcgtggcgcagcttcaggacaagggttcggtctcgcgcggctggctcggg
gtcacggttcagggcatgactcccgagatcgctcaggccatggggcttgaggggcgcgac
ggggcccttgtggccgaggtgcagcagggtagccccgccgacgagggcggtctcgagagc
ggcgacgtcatcacggcggtgaacggtcaggagctgacggagcgggcgagcctgccgcgg
ctgatcgcggccatcccgaacggcgagaaagcccaactcacggtccagcgcgatggacgc
cagcaggagatgaccgtgacgatcggagaactgacccccgaccgggcgcaggtcgcctcg
gccgagtcgcccgaagggctcggcgggccgctcggcatcgaggtccagccgctcgagccc
gcgctggcacgccagctcggcctgccggacggcgcctcgggcgtcgtggtgacggcggtc
gatccctcggggccgaacgccgaccggctcgcgccgggcgacgtgatccaggaagcggcc
ggccacccgatcgagacgccgcgcgatctggcctcggcgatgcgcgaggcgcgcggcaag
ggcgtgatgctgatgaaggtgctgcggcagggcaacccggtctatgtgggcgccgaagtg
gcctcgtcctga

DBGET integrated database retrieval system