KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3249Help
Entry
RSP_3249          CDS       T00284                                 

Definition
(RefSeq) ABC peptide transporter, duplicated ATPase domains
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp02024  Quorum sensing
Module
rsp_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RSP_3249
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsp02000]
    RSP_3249
Transporters [BR:rsp02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    RSP_3249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 AAA_22 AAA_16 AAA_29 SMC_N MMR_HSR1 RsgA_GTPase Mg_chelatase AAA_33 NACHT AAA_18 AAA_5 AAA IstB_IS21 AAA_24 PRK ArgK NB-ARC DUF87 ATP-synt_ab Dynamin_N Septin
Motif
Other DBs
NCBI-GeneID: 3721851
NCBI-ProteinID: YP_354759
UniProt: Q3IX76
Position
2:complement(306500..308173)
Genome map
AA seq 557 aa AA seqDB search
MSLLAIRDLEIRFRDGTEERLLIDRVSLELKKGEILGLVGESGSGKSLLCRAVMGLLPSR
KLSVTKGHVSLAGRDITRLPEREMLDIRGRRIGMIFQNPTSHLDPVMRIGDQIAEGLCRH
RGLPRAAAREEAVTILRQVGFTDPPRQARMYAHEFSGGMRQRAMIAVALACDPDILIADE
PTTALDVTIQAQILRQLADLRESRGLSIILITHDLGVVAQTCDRIAVMRDGRIVEEGEKR
RLLAAPQHPYTQALIASHPSLPHEEAVGEPYQPHSRPLIEIDDLEVSFPAGGSPWARRRF
KAVDGVSLRIGRGETVGIVGESGSGKSTLARTLLGLQPVTSGHVAFDGSVLTLERARTLA
RLRREAAMVFQDPFNALNPRLTVGETLAEVLRVQGKVARAAIPARVNELLDMVGLDRGFA
DRRPRSLSGGQCQRAGIARALAVDPTLIVADECVAALDVTIQAQIVELFRTLVAAQGLTL
LFIAHDLAIVRSLCERVVVMQHGRVVEDGPSAEVFARPSHPYTAALIAAIPSIDPDQPLA
AAMPDPRSQTQQEGLLT
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcttgccatccgcgacctcgagatccgcttccgcgacggcaccgaggaacgg
cttctcatcgaccgggtctcgctcgagctgaagaagggcgagatcctgggcctcgtgggc
gagagcggctcgggcaagagcctgctctgccgcgcggtgatgggacttctgccctcgcgc
aagctctcggtcacgaaggggcatgtgagccttgccgggcgcgacatcacccgcctgccc
gagcgcgagatgctggacatccgcgggcggcggatcgggatgatctttcagaacccgacc
agccacctcgatccggtgatgcggatcggcgatcagatcgccgaagggctctgccgtcac
cgcggcctgccccgcgccgccgcgcgcgaggaggcggtgacgatcctgcggcaggtgggc
ttcaccgacccgccgcggcaggcgcggatgtatgcgcacgaattctcgggcgggatgcgc
cagcgcgcgatgatcgcggtggcgcttgcctgcgatcccgatatcctgatcgcggacgag
cccaccaccgcgctcgacgtgacgatccaggcgcagatcctgcgccagctggccgatctg
cgcgagagccggggtctctcgatcatcctcatcacccacgatctgggcgtcgtggcccag
acctgcgaccggatcgccgtcatgcgcgacgggcgcatcgtcgaggagggcgagaagcgc
cgcctgctcgcggccccgcagcatccctatacccaggcgctgatcgcgtcgcatccctcg
ctcccccacgaggaagcggtgggcgagccctatcagccccacagccgcccgctgatcgag
atcgacgatctcgaggtgagcttccccgccggaggatcgccctgggcgcggcggcgcttc
aaggcggtggacggggtgagcctgcgcatcgggcgcggcgagacggtggggatcgtgggc
gagagcggctcgggcaagagcacgctcgcccgcacgcttctggggcttcagcccgtcacc
tcgggtcatgtggccttcgacggctcggtgctgacgctcgaacgcgcacggacgctcgcc
cggctgcggcgcgaggcggcgatggtgtttcaggatccgttcaacgcgctgaacccgcgc
ctcaccgtgggcgagacgctggccgaggtgctgcgcgtgcagggcaaggtggcgcgcgca
gccatccccgcgcgggtgaacgagcttctcgacatggtggggctcgaccgcggcttcgcc
gaccgcaggccccgcagcctgagcggcggccagtgccagcgcgcgggcatcgcgcgggcg
ctcgccgtcgatccgacgctgatcgtggccgacgaatgcgtggcggccctcgatgtcacg
atccaggcgcagatcgtggagctcttccgtacgctcgtggcggcgcaggggcttacgctc
ctcttcatcgcgcacgatctggccatcgtccgctcgctctgcgagcgggtcgtggtcatg
cagcacgggcgcgtggtcgaggacgggccctcggccgaggtcttcgcccgcccctcccat
ccctataccgcggcgctgatcgcggccatcccgagcatcgaccccgaccagccgctggcg
gccgcgatgcccgaccccagaagccagacccaacaggaaggactgctcacatga

DBGET integrated database retrieval system