KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3250Help
Entry
RSP_3250          CDS       T00284                                 

Definition
(RefSeq) ABC peptide transporter, inner membrane subunit
  KO
K02034  peptide/nickel transport system permease protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp02024  Quorum sensing
Module
rsp_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    RSP_3250
Transporters [BR:rsp02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    RSP_3250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OppC_N
Motif
Other DBs
NCBI-GeneID: 3721852
NCBI-ProteinID: YP_354760
UniProt: Q3IX75
Position
2:complement(308170..308997)
Genome map
AA seq 275 aa AA seqDB search
MIAALGLPVRRRPMLAIGTALLLAFLLAALLAPWIAPFDPIAQDGSIRLQPPSLAHPFGT
DNFGRDVLSRVIWGARIDLQIAVLGVLFPFLIGTAVGTLAGFFGGWIDALFMRLIDVILA
FPFLVLMLSIIAILGPGLTSFYIAMALVGWVSYARLIRAQILVLKTQDFAVAAQSLGFSR
TRIMFRHLLPNALAGSLVFVMSDAVLVLLNGAAISYLGLGVQPPLAEWGVMVAEGQAFIT
TAWWITLFPGLAIVTLAFGFSLLGDALGDLLGVKE
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgccgcgctcggcctgcccgtccgccgccgcccgatgctggccatcgggaccgcg
ctccttctggccttcctcctcgcggcgctgctcgcgccctggatcgcgcccttcgatccg
atcgcacaggacggatcgatccgcctgcagccgccgagcctcgcccatccgttcggcacc
gacaatttcggccgcgacgtgctctcgcgggtgatctggggcgcccggatcgatctgcag
atcgcagtgctgggggtgctctttcccttcctgatcggcacggccgtgggcacgctcgcg
ggcttcttcggcggctggatcgacgcgctcttcatgcgcctgatcgacgtgatcctggcc
ttccccttcctcgtcctgatgctctcgatcatcgcgatcctcgggcccgggctcaccagc
ttctacatcgccatggcgctggtgggctgggtctcctatgcgcggctgatccgggcgcag
atcctcgtgctcaagacgcaggatttcgcggtggcggcccagagcctcggcttctcgcgc
acccggatcatgttccgccatctgctgcccaatgcgctggcgggctcgctcgtcttcgtc
atgtcggacgcggtgctcgtgctgctcaatggcgcggcgatcagctacctcgggctcggg
gtgcagcccccgctcgcggaatggggggtcatggtggcggagggtcaggccttcatcacc
accgcctggtggatcaccctgttcccgggcctcgccatcgtcacactggccttcggcttc
agcctgctgggcgacgcgctcggcgatcttctgggggtgaaggaatga

DBGET integrated database retrieval system