KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3253Help
Entry
RSP_3253          CDS       T00284                                 

Definition
(RefSeq) putative acetamidase / formamidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00330  Arginine and proline metabolism
rsp00360  Phenylalanine metabolism
rsp00380  Tryptophan metabolism
rsp00627  Aminobenzoate degradation
rsp00643  Styrene degradation
rsp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    RSP_3253
   00360 Phenylalanine metabolism
    RSP_3253
   00380 Tryptophan metabolism
    RSP_3253
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RSP_3253
   00643 Styrene degradation
    RSP_3253
Enzymes [BR:rsp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     RSP_3253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FmdA_AmdA
Motif
Other DBs
NCBI-GeneID: 3721855
NCBI-ProteinID: YP_354763
UniProt: Q3IX72
Position
2:complement(311975..312934)
Genome map
AA seq 319 aa AA seqDB search
MCKACNYTIHGAQHHFGWDNSLPPAERVEPGSTILFHCQDSSAGQLGPSSVLADVVALDF
GRINPVSGPIHVEGAEPGDALKVTIESFTPQVREGTGWGWTANIPGFGLLADQFTEAALH
IWKYDAESLAPALWGKEGRVPLKPFAGTIGNALAEPGLHSVVPPRRVGGNLDIRDLAAGT
TLYLPVEVAGALFSVGDTHAAQGDGEVCGTAIESPMDVVLTLDLVKGANLKTPRFTTPGP
VTRHLDAKGYEVTTGIGPDLMSGARDAVSAMIDHLCATRGMAPVEAYMLVSTCGDLRISE
IVDMPNWVVSFYFPRAVFE
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaaggcctgcaattacacgatccacggcgcgcagcatcacttcggctgggacaat
tcgctccccccggccgagcgtgtggagcccggctcgaccatcctcttccactgccaggat
tcctcggcaggccagctcggaccctcgtccgtgctggccgacgtggtggcgctcgatttc
ggccggatcaacccggtctcgggcccgatccatgtcgagggggccgagccgggcgacgcg
ctgaaggtcacgatcgagagcttcaccccgcaggtgcgcgagggcacgggctggggctgg
acggccaacatcccggggttcggcctcctggccgaccagttcaccgaagccgcgctccat
atctggaaatacgatgccgagagcctcgcgcccgcgctctggggcaaggaggggcgcgtg
ccgctcaagcccttcgcgggcaccatcggcaatgcgctggccgagccggggctgcattcg
gtggtgccgccccggcgcgtgggcggcaacctcgacatccgcgacctcgcggcgggaacg
acgctctacctgccggtcgaggtggccggggcgctgttcagcgtgggcgacacccatgcg
gcgcagggcgacggcgaggtctgcggcacggccatcgaaagcccgatggatgtggtcctg
acgctcgatctggtgaagggcgcgaacctcaagaccccgcgcttcaccacgcccgggccc
gtcacgcgccacctcgacgccaagggctacgaggtcaccaccggcatcgggcccgacctg
atgagcggggcgcgcgatgcggtctcggcgatgatcgaccatctctgcgccacgcggggc
atggcgccggtcgaggcctacatgctggtctcgacctgcggcgacctgcggatctccgag
atcgtggacatgccgaactgggtcgtgagcttctacttcccgcgcgccgtcttcgaatga

DBGET integrated database retrieval system