KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3257Help
Entry
RSP_3257          CDS       T00284                                 

Definition
(RefSeq) ABC peptide transporter, inner membrane subunit
  KO
K02033  peptide/nickel transport system permease protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp02024  Quorum sensing
Module
rsp_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    RSP_3257
Transporters [BR:rsp02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    RSP_3257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 3721857
NCBI-ProteinID: YP_354765
UniProt: Q3IX70
Position
2:complement(314584..315504)
Genome map
AA seq 306 aa AA seqDB search
MPAYLLRRLFQSALILLGVSLVTFILLYVLPADPVRQIAGRSATPQVVENIRRQLGLDQP
FLVQYGRYLWGLMQGDFGRSYLQKTDVATLIAARLPATLQLMGGAILCELVLGLTMGIVA
ALRRGRALDQGLMIVSFVAVSAPQFVVSLLLLYVFAVKLGWFPIGGYGTLSHLVLPAVTL
GILGSGWYSRMMRSSMIDVLRQDYIRTARAKGLTRGRVILRHALPNAILPIVAMIGIDIG
IFMGGIVVVESVFGWPGIGQLAWQAIQRIDIPIIMGVTMVSACAIVLGNLLADLVTPFID
PRIKLK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcctatctccttcgccgcctgttccagtcggccctgatcctgctcggcgtctcg
ctcgtcaccttcatcctgctctatgtgctgccggccgatccggtgcgccagatcgcgggc
cgctcggccacgccgcaggtggtcgagaacatccgccgccagctcggtctcgaccagccc
ttcctcgtgcagtacggtcgctatctctgggggctcatgcagggcgatttcgggcgcagc
tacctgcagaagaccgatgtggcgacgctgatcgcggcgcgcctgcccgccaccctgcaa
ctgatgggcggcgcgatcctgtgcgagctggtgctgggcctgaccatgggcatcgtcgca
gccctccggcgcggacgggcgctcgatcaggggctgatgatcgtctccttcgtcgcggtc
tcggcaccgcagttcgtggtgagcctgctcctcctctatgtcttcgcggtcaagctcggc
tggttccccatcggcggctacggcacgctctcgcatcttgtgctgcccgccgtcacgctc
gggatcctcggctcgggctggtacagccggatgatgcgctcgagcatgatcgacgtgctg
cgtcaggactatatccgcaccgcccgcgccaagggcctcacgcgcggccgcgtgatcctg
cgccacgcgctgccgaacgcgatcctgcccatcgtggccatgatcggcatcgacatcggc
atcttcatgggcggcatcgtcgttgtggaaagcgtgttcggctggcccggcatcggccag
ctggcctggcaggccatccagcgcatcgacatcccgatcatcatgggcgtcaccatggtc
tcggcctgcgccatcgtgctgggcaaccttctggccgatctcgtgacgcccttcatcgac
ccccgcatcaagctgaaataa

DBGET integrated database retrieval system