KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3260Help
Entry
RSP_3260          CDS       T00284                                 

Gene name
amiC
Definition
(RefSeq) amino acid/amide ABC transporter substrate-binding protein, HAAT family
  KO
K01999  branched-chain amino acid transport system substrate-binding protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp02010  ABC transporters
rsp02024  Quorum sensing
Module
rsp_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RSP_3260 (amiC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RSP_3260 (amiC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsp02000]
    RSP_3260 (amiC)
Transporters [BR:rsp02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    RSP_3260 (amiC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_5 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 3721860
NCBI-ProteinID: YP_354768
UniProt: Q3IX67
Position
2:complement(316965..318026)
Genome map
AA seq 353 aa AA seqDB search
MKRRIDLGLLYSRSGSYALISDACRTGALAAVAEVNAGPFDLELVPVERDPGGNIDFYAP
LCEELLAHEGLRHVVGCVTSWSRKEVIPTLEKARGTLWYAVPYEGFEASDHVVYTHACPN
QHLLPLLDWAFPAFGRRAYLTGSNYIWGWEMNRLARERIGAAGGKVLGERYLPIGSLEID
RMIEEIRATAPDFILNSLIGPSSYAFLKAYQALGREDARFRPDRCPVMSCNLTECELPAL
GDAAEGLIAAGPYFRGEGRFGSSHEAAAHAAVMELARLLSGRPGAERLPLSQLLAGSPPG
IVDPQTHHTALPVLISQVSGGRFTVRERLPARPGDPYLTHPAPARPATLRIVS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgacgcatcgaccttggacttctctactcccgctcgggcagctacgcgctgatc
tcggacgcctgccgcaccggggcgctggccgccgtggccgaggtgaatgccgggcccttc
gatctggagctggtgccggtcgagcgcgatcccggtggcaacatcgacttctatgcccct
ctgtgcgaagaacttctggcccatgaggggctgcgtcacgtcgtgggctgcgtcacctcc
tggagccgcaaggaggtgatcccgacgctggagaaggcgcgtgggacgctctggtatgcg
gtgccctacgagggcttcgaagcctcggaccatgtggtctatacccatgcctgcccgaac
cagcacctgctgccgctgctcgactgggcctttccggccttcggccgccgcgcctacctg
acggggtcgaactacatctggggctgggagatgaaccggctggcgcgcgagcggatcggg
gcagcgggcggcaaggttctgggcgaacgctacctgcccatcggatcgctcgagatcgac
cggatgatcgaggagatccgcgcgaccgcgccggatttcatcctgaattcgctgatcggc
ccctcctcctatgccttcctcaaggcctatcaggcgctggggcgcgaggatgcccgcttc
cgtccggaccgctgcccggtgatgtcctgcaacctcaccgaatgcgagctgcccgcgctg
ggggatgcggccgaggggctgatcgccgccggaccctacttccgcggcgagggccggttc
ggctcgtcgcacgaggcggcggcccatgcagcggtgatggagcttgcacgcctgctctcc
ggccgtccgggcgccgagcggcttccgctttcgcagctgctcgcagggtcccctccgggc
atcgtcgatccgcagacgcatcacaccgcgctgccggtcctgatctcacaggtctcgggc
ggccggttcacggtgcgcgagcgcctgcccgcacgtcccggggatccctacctgacccat
cccgcgcccgcacgcccggccacgctgcggatcgtgtcatga

DBGET integrated database retrieval system