KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3272Help
Entry
RSP_3272          CDS       T00284                                 

Gene name
ggt
Definition
(RefSeq) gamma-glutamyltransferase 1
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00430  Taurine and hypotaurine metabolism
rsp00460  Cyanoamino acid metabolism
rsp00480  Glutathione metabolism
rsp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    RSP_3272 (ggt)
   00460 Cyanoamino acid metabolism
    RSP_3272 (ggt)
   00480 Glutathione metabolism
    RSP_3272 (ggt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rsp01002]
    RSP_3272 (ggt)
Enzymes [BR:rsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     RSP_3272 (ggt)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione hydrolase
     RSP_3272 (ggt)
Peptidases [BR:rsp01002]
 Threonine Peptidases
  Family T3: gamma-glutamyltransferase family
   RSP_3272 (ggt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 3721873
NCBI-ProteinID: YP_354781
UniProt: Q3IX54
Position
2:complement(330146..331933)
Genome map
AA seq 595 aa AA seqDB search
MPMVRTLALFLASALPAFAQQASDTLAPEAPTAPAAFGSLSPAAAAAMETRDSGRPVEAE
DWMVVAANPLAVEAGAEILRSGGSAADAMVAVQTVLGLVEPQSSGLGGGAFLVWFDAATG
AVTTLDARETAPRAATPRLFQTPEGEPLEFLDAVVGGRSVGTPGTPLLLEEAHRRWGRSG
WSDLFDPAIRLAEEGFAVSPRLAGLVAEDPEGLSRFPATAAYFLPEGQPLKAGALLKNPD
YAETLRRLAAEGADAFYRGPIAEEIVATVRGAEGNPGVLALEDLAAYRVVERPPVCADYR
GAEICGMGPPSSGALTVGLILGALEPYDLAALGPENAESWRLIGDATRLAFADRGRYMAD
RDFVPVPVEGLLDPAYLAARAELLRGDDALPEVAAGTPEWDHAGLLAPDESLELPSTSHI
SIVDAAGNVLSMTTTIENGFGSRLMTNGFLLNNELTDFSFRTHAEGWPIANRVEPGKRPR
SSMAPTIVLRDGKPVLAVGSPGGSTIIGYVAQALIAHLDWGMDVQQAVAMPHLVNTFGPF
QIEAGTRAEALSQPLADLGYDVKPVDLTSGLHAISLGERLQGGADPRREGIALGE
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgcccatggtccgcacgctcgccctgttcctcgcctcggccctgcccgccttcgcgcaa
caggccagcgacacgctggcccccgaggcgcccaccgcgcccgcggccttcggcagcctc
tcgcccgcagccgccgcggcgatggagacgcgcgactcgggacggcccgtcgaggcggag
gactggatggtggtggctgcgaacccgctcgccgtcgaggccggagccgagatcctgcgc
agcggcggcagcgcggccgatgccatggtcgccgtccagaccgtgctggggctggtcgag
ccgcaatcctcggggctcggcggcggcgccttcctcgtctggttcgatgcggcgaccggc
gccgtcaccacgctcgatgcgcgcgagaccgcgccgcgggccgcgaccccccggctcttc
cagacgcccgagggcgagccgctggaattcctcgacgcggtggtgggcggccggtccgtg
ggcacccccggcacgccgcttctgctcgaggaggcgcaccggcgctggggcaggtccggc
tggtccgacctcttcgatccggccatccgtctggccgaggagggctttgcggtctcgccg
cgtctcgcggggctcgtggccgaggatcccgaggggctctcgcgctttcccgccaccgcc
gcctatttcctgcccgagggccagccgctgaaggccggagccctcctgaagaaccccgac
tatgccgagacccttcgccgtctggcggccgaaggcgcggatgcgttctaccgcggcccc
atcgccgaggagatcgtggccaccgtccgcggcgccgagggcaatccgggcgtgctcgcg
ctcgaggatctggccgcctaccgcgtggtggagcgtccgcccgtctgcgccgactaccgc
ggcgccgagatctgcggcatgggtccgccctcgtcgggagcgctgaccgtggggctgatc
ctcggcgcgctcgagccctacgatctggccgccctcgggcccgagaatgccgaaagctgg
cgcctgatcggcgatgcgacccgcctcgccttcgccgaccgcggccgatacatggccgac
agagatttcgtgccggtgcccgtcgaggggctgctcgatcccgcctatctcgccgcccgg
gccgagcttctgcgcggagacgatgcgttgcccgaggtggcggccggcacgcccgaatgg
gatcacgcggggctcctcgcccccgacgagagcctcgaattgccctcgacctcgcatatc
tccatcgtggatgcggcgggcaacgtgctctcgatgacgacgaccatcgagaacggcttc
ggctcgcggctgatgacgaacgggttcctcctgaacaacgaactcaccgacttctccttc
cgcacccatgcggagggctggcccatcgcgaaccgggtggagcccggcaagcgcccgcgc
tcgtcgatggcgcccaccatcgtactccgcgacggcaagcccgtgctggcggtgggcagc
cccggcggctccacgatcatcggctatgtggcacaggcgctgatcgcccatctcgactgg
ggcatggatgtgcagcaggcggtggccatgccgcatctcgtgaacactttcggcccgttc
cagatcgaggccggcacccgcgccgaagcgctgagccagccgctcgccgatctgggttat
gacgtgaagccggtggacctgacctccggcctccatgcgatctcgctgggcgagaggttg
cagggcggcgccgatccccgccgcgagggaatcgcgctgggcgagtga

DBGET integrated database retrieval system