KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3276Help
Entry
RSP_3276          CDS       T00284                                 

Definition
(RefSeq) hypothetical protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF58
Motif
Other DBs
NCBI-GeneID: 3721877
NCBI-ProteinID: YP_354785
UniProt: Q3IX50
Position
2:334876..335727
Genome map
AA seq 283 aa AA seqDB search
MTGEGHEVTVAGLLALAPLAAQRGRRPPEPARRPGSTATRPRGQGHEIREIRPFTEGDDL
RHLDAAATARTGTLQVRSFHEDRDRTVLLVADFRRPMLWGTRRFRSVAAAEALALAGWQA
VNGGGSAGAVALTDGGLHSSRASGRTAGMAQAAGCLARGHRAALAAVRQPVRDLGPDLLR
AARLAPRGATVILATALDRPGPEFEAALGAVLRRGPLRLLLAVDPFETDPPRQALPFLTA
EGRAGRGGFADLPATRAATLDRLAELGVTAERLPADLPLGAGP
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcgagggccatgaggtgacggtggcagggcttctggcgctggccccgctcgcg
gcccaacgcgggcgtcgcccgcccgagcccgcgcggcggccgggatcgaccgccacgagg
ccccgcgggcaggggcacgagatccgcgagatccggcccttcaccgagggcgacgacctt
cgccacctcgacgcggccgccaccgcgcgcaccggcacgcttcaggtgcgcagcttccac
gaggaccgcgaccggaccgtgctgctcgtggccgactttcgccgcccgatgctgtggggc
acgcggcgtttccgctcggttgcggcggccgaggcgctggcgctggcgggctggcaggcg
gtgaacggcgggggctcggcgggcgcggtggcgctgacggacggcgggctccattcctcg
cgcgcctcgggccggacggcgggcatggcgcaggccgcgggctgccttgcgcggggccac
cgcgcggcgctcgcggcggtgcgccagccggtgcgggatctcggacccgatctgttgcgc
gcggcccgcctcgcgccgcgcggcgcgacggtcatccttgcgaccgcgcttgaccggccg
gggccggagttcgaggcggcgctcggcgcggtcctgcggcggggcccgctccggctcctt
cttgcggtggacccgttcgagaccgatccgccgcggcaggcgctgcccttcctcacggcc
gagggcagggcggggcgcggcggcttcgccgatctgcccgccacgcgcgcggcgaccctc
gaccggttggcggagctgggagtcaccgccgagcggttgcctgcggacctgcccctcgga
gccggcccatga

DBGET integrated database retrieval system