KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3278Help
Entry
RSP_3278          CDS       T00284                                 

Definition
(RefSeq) Von Willebrand domain containing protein
  KO
K07114  Ca-activated chloride channel homolog
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Brite
Transporters [BR:rsp02000]
 Other Transporters
  Pores ion channels [TC:1]
   RSP_3278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA VWA_2 DUF1194 VWA_CoxE VWA_3 YjbF
Motif
Other DBs
NCBI-GeneID: 3721879
NCBI-ProteinID: YP_354787
UniProt: Q3IX48
Position
2:336076..337062
Genome map
AA seq 328 aa AA seqDB search
MLDLAAPFFLLLLPLPFLVRRFLPPHAAQEGALYLPEAFAAAARPTSAFARSERWEGALR
AILWLALVLALAGPERLKAVPDLSASGREIVLTLDMSGSMLIEDFDIDGVQSTRLEAVKR
VARSFVEERQGDRIGLVLFANRAYVAAPLTFDLAAVGRAIEEASIGITGRSTAIADGLGL
ALKSVTESSAASRVIVLLSDGQDNAHQIDARQVAGLAARHGVRIHTIALGPDDLETRPAA
RDAVDTATLRAIAEASGGRSYRVRGMEDLRAMAADLDRLEPNPAERPPVLVPEPLWPWPA
LLALGAALVLGLRRAGLAPWPRRAGRAA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatctcgcggcccctttcttcctgctgctcctgccgctgccgttcctcgtccgc
cggttccttccgccccatgcggcgcaggagggggcgctctacctgcccgaggcctttgcc
gccgcggcccgccccacctcggcctttgcccgcagcgagcggtgggagggggccctgcgg
gcgatcctgtggctcgcgctggtgctggcgctggcagggcccgagcggctgaaggcggtg
ccggatctttccgcctcggggcgcgagatcgtgctgacgctcgacatgtcgggctcgatg
ctgatcgaggatttcgacatcgacggggtgcagagcacgcggctcgaggcggtcaagcgg
gtggcgcgcagcttcgtcgaggagcggcagggcgaccggatcggcctcgtcctctttgcg
aaccgcgcctacgtggccgcgcccctgaccttcgatctggcggcggtggggcgggccatc
gaagaggcctcgatcggcatcaccggccgctcgaccgccatcgccgacgggctggggctt
gcgctgaagagcgtgaccgagagcagtgcggcctcgcgggtgatcgtgcttctgtcggac
gggcaggacaatgcgcaccagatcgacgcgcggcaggtggcagggctcgcggcgcggcac
ggggtgcgcatccacacgatcgcgctcggtccggacgatctcgagacccgtccggccgcc
cgcgatgcggtggacacggccacgctccgcgccattgccgaggcgagcgggggacggagc
taccgcgtgcgggggatggaggatctgcgcgccatggcggccgacctcgaccggctggag
ccgaaccctgcggaacggccgccggtgctggtgcccgagccgctctggccctggcccgcg
cttctggcgctgggggcggctctcgtcctcggcctccgccgggcagggctggcgccgtgg
ccccgtcgggcagggcgcgcggcatga

DBGET integrated database retrieval system