KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3280Help
Entry
RSP_3280          CDS       T00284                                 

Definition
(RefSeq) hypothetical protein
  KO
K07114  Ca-activated chloride channel homolog
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsp02000]
    RSP_3280
Transporters [BR:rsp02000]
 Other Transporters
  Pores ion channels [TC:1]
   RSP_3280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2
Motif
Other DBs
NCBI-GeneID: 3721880
NCBI-ProteinID: YP_354788
UniProt: Q3IX47
Position
2:337059..337994
Genome map
AA seq 311 aa AA seqDB search
MSWLLLRPLWLAALPLLALLALWVWRRRPAGAWERIVAPPLLARMRELGFVAPAGGRWTG
LLPFAVAALVIVGLSGPARLRPDSLAFDRMDPILLVLDMSPSVAGTAQLGDAQAAAALVL
QEAKGRPTGLMLYAADAYVASAPTSDAASLQSLVAVLGAETMPVEGSRPDIALSVARELF
AGEGRPGLAGADLIVISDGGGVGPRAWEEARRLRAAGARVWALELPRDRLPEGMPEPPAD
ALAELARAGGGALAPVRTPRPLLERLGQARTRALARSAEGPALFEDLGRWLLLLAALPAL
LLFRRPLSEKS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagctggctcctcctccgcccgctctggcttgcggccctgccgctgctcgcgcttctg
gcgctctgggtctggcggcgccgtccggccggcgcgtgggagcggatcgtggccccgccg
cttctggcgcggatgcgtgagctgggcttcgtggccccggcgggcgggcgctggacggga
ctgctgcccttcgccgtcgcggcgctcgtcatcgtcggtctgtccgggccggcaaggctc
cgacccgacagtctcgccttcgaccggatggatccgatcctcctcgtgctcgacatgtcg
ccttcggtggctggcacggcgcagctcggcgatgcgcaggcggcggcggcgctcgtgctg
caggaggcgaaggggcggcccacgggcctcatgctctatgccgccgacgcctatgtggcg
agcgcgcccaccagcgacgcggcctcgctccagagcctcgtcgcggtgctcggcgccgag
acgatgcccgtggagggaagccggcccgacatcgcgctctcggtggcacgcgagctcttt
gcgggcgagggccggcccgggctcgccggcgccgacctcatcgtgatctccgacggaggc
ggcgtcggcccgcgcgcctgggaagaggcgcgtcgcctgcgcgcggcgggcgcgcgggtc
tgggcgctggagctgccgcgcgaccggctgcccgaggggatgcccgagcctcccgccgat
gcgctggccgagcttgcccgggcgggtggcggggcgctggccccggtccgcacgccgcgc
ccgctgctggaacggctcgggcaggcgcgcacccgcgcgctcgcccgctcggccgaaggg
cccgcgctcttcgaggatctcggtcgctggctcctcctcctcgcggcgcttccggccctg
ttgctgttccgccgcccgctctcggagaaaagctga

DBGET integrated database retrieval system