KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3281Help
Entry
RSP_3281          CDS       T00284                                 

Definition
(RefSeq) hypothetical protein
  KO
K07114  Ca-activated chloride channel homolog
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsp02000]
    RSP_3281
Transporters [BR:rsp02000]
 Other Transporters
  Pores ion channels [TC:1]
   RSP_3281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_2 TPR_1 TPR_16 TPR_12 TPR_14
Motif
Other DBs
NCBI-GeneID: 3721881
NCBI-ProteinID: YP_354789
UniProt: Q3IX46
Position
2:337994..338590
Genome map
AA seq 198 aa AA seqDB search
MRRRLLALAALAAVGLGGPTAWAKLALLAGLPGLAATFATEPAIRGVALYQARRFAEADA
AFAEAGRAVTYNRGLSLAALGNYPLAEAYFDAVLFANPADSEARENRDRVAALYDPVVGQ
GDEAGRIAVQVVVPPDGPPTERFSADSPPLGPGRQVADDAWLATLPDDPGEFLRLRLSDE
YTRRLSLGFTPPEEGDPW
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcgccggaggctccttgcgcttgcggcgctggccgccgtgggcctcggagggcccacc
gcctgggccaagctcgcgctcctcgcaggcctgccgggcttggcggccaccttcgcgacc
gagcccgcgatccggggcgttgcgctctatcaggcgcgccgctttgccgaggccgatgcc
gccttcgccgaggcgggtcgcgccgtcacctacaaccgcggcctgagcctcgcggcgctt
ggaaactatccgcttgccgaggcctatttcgacgcggtgctcttcgccaatcccgccgac
agcgaggcgcgcgagaaccgggacagggtggccgcgctctacgatcccgtggtggggcag
ggcgacgaggccggccggatcgccgttcaggtggtggtcccgcccgacgggccgccgacc
gagcggttctcggccgactcgccgccgctcgggccggggcggcaggtcgccgacgatgcg
tggcttgccacgctgcccgacgatccgggcgagttcctgcggctcaggctctcggacgaa
tatacccggcggctgtcgctgggcttcacaccgccggaggagggcgatccatggtga

DBGET integrated database retrieval system