KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3282Help
Entry
RSP_3282          CDS       T00284                                 

Definition
(RefSeq) hypothetical protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BatD
Motif
Other DBs
NCBI-GeneID: 3721882
NCBI-ProteinID: YP_354790
UniProt: Q3IX45
Position
2:338584..339753
Genome map
AA seq 389 aa AA seqDB search
MVIRAALAALAALVLLAATTAGAETPERRLEILAFPRADSVVAGEMVPVTVRGIYDRKVT
LEEMTIRPGDSFDWVQLAKDDWHEERIDGRLRLVVERRLALFPKHSGSSRFGPAEHRLTF
VGAGGKAETITSHPLDLSVAPMPDDPPFHSPHGWRFAASELRVKDELSTDPARLRDGETV
TRRVTVTGVGALPAMLPPRPVVSENWLIAFAAPVERSLELTPEGPVARVIWSWQFRPETG
EPGVLPAVPIPYFNTVTRKVEAAEIPALPIGYASFAASQSAGIAITPASLWGGLAAGLAG
LGAGTALLVAGHRPTAAALGRLARRRSPFRRWQIWRAARAGDLLALRRATEEEALDRPAA
RAALERAIYGPPPQPFDARAFLRTLRRKA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggtgatccgtgcggctctggcggctctggcggctctcgtgcttctcgcggccacgacg
gccggggccgagacccctgagcggcggctcgagatcctggccttcccccgcgccgacagc
gtggtggcgggcgagatggtgccggtgacggtgcgcggcatctacgaccgcaaggtgacg
ctcgaggagatgacgatccggcccggcgacagtttcgactgggtgcagctggccaaggac
gactggcacgaggagcgcatcgacggccgcctgcggctggtggtcgaacgcaggctcgcg
ctctttcccaaacattccggctcgtcgcgcttcgggcccgccgagcaccggctgaccttc
gtcggcgcgggcgggaaggcggagaccatcacctcgcatccgctcgacctgtcggtggcg
cccatgcccgacgatccgcccttccacagcccgcacggctggcgcttcgccgcctccgag
ctgagggtgaaggacgagctcagcaccgatccggcccggctcagggacggcgagaccgtg
acgcggcgcgtgactgtgacgggggtaggggcgctgcccgcaatgctgccgccgcggccc
gtcgtctcggagaactggctcatcgccttcgcggccccggtcgagcggtcgctggagctg
acgccggagggccccgtggcgcgggtgatctggagctggcagttccgccccgagaccggc
gagcccggcgtgctgcccgccgtgccgatcccttatttcaacacggtgacgcggaaggtg
gaggcggccgagatccccgcgctgcccatcggctatgcaagcttcgccgcctcgcagtcg
gccggcatcgccatcacgccggcgagcctctggggagggctggcggccggtctggcgggg
ctcggcgcggggacggcgctgctcgtggccggccaccggccgacggccgcggcgctcgga
cggctcgcgcggcggcgctcgcccttccgccgctggcagatctggcgcgcggcacgggcg
ggtgacctgctcgcgctccgccgggccaccgaggaggaggcgctcgacaggcctgcagcg
cgcgccgcgctcgaacgggcgatctacggcccgccgccgcagccgttcgacgcgcgcgcc
tttctgcggaccctgcgccggaaggcttga

DBGET integrated database retrieval system