KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3286Help
Entry
RSP_3286          CDS       T00284                                 

Gene name
iolB
Definition
(RefSeq) 5-deoxy-glucuronate isomerase
  KO
K03337  5-deoxy-glucuronate isomerase [EC:5.3.1.30]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00562  Inositol phosphate metabolism
rsp01100  Metabolic pathways
rsp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    RSP_3286 (iolB)
Enzymes [BR:rsp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.30  5-deoxy-glucuronate isomerase
     RSP_3286 (iolB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KduI
Motif
Other DBs
NCBI-GeneID: 3721886
NCBI-ProteinID: YP_354794
UniProt: Q3IX41
Position
2:343854..344660
Genome map
AA seq 268 aa AA seqDB search
MTILLHRPFGSHGKVHEITPASAGWRYVGFSLYRLRPGEVAAETTGDREVILVLVEGRAS
VSGGGQDWGVLGERLSVFEKTPPHSLYLPDGSAWQAVAETACTIAVCSAPGRGGHAARRI
GPEGIVLTERGKGTNRRQIHNIAMEAEDVCDSLLVTEVFTPAGHWSSYPSHRHDEDDYPR
ITYLEETYYHRLNPANGFGIQRVYTDDLRLDETMAVQDGDVVCVPRGHHPCGAPYGFEMY
YLNVMAGPLRKWRFVAAPEVEWILKRDA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgacgatattgctgcaccggcccttcggcagccacggcaaggtgcatgagatcaccccg
gcctcggcgggctggcgctatgtgggcttctctctctaccggctccggccgggcgaggtc
gcggccgagaccacgggggatcgcgaggtcatactggtcctggtcgagggccgggcctcc
gtctccggcggcggacaggactggggcgtgctgggcgagcgcttgtccgtcttcgagaag
acgccgccgcattcgctgtatctccccgacggcagcgcgtggcaggcggtggccgagaca
gcctgcacgatcgccgtctgctccgcgcccggacgcggcggccatgcggcccggcggatc
gggcccgagggcatcgtgctcaccgagcgcggcaagggcacgaaccgccgccagatccac
aatatcgccatggaggcggaggacgtctgcgactcgctcctcgtgaccgaggtcttcacc
ccggcgggtcactggtcctcctatccgagccaccgccacgacgaggacgattatccccgc
atcacctatctcgaggagacctattatcaccgcctgaaccccgccaacgggttcggcatc
cagcgggtctataccgacgatctgcgcctcgacgagacgatggcggtgcaggacggagac
gtggtctgcgtgccgcgcgggcaccatccctgcggcgcaccctacgggttcgagatgtat
tacctgaatgtcatggccggcccgttgcgcaaatggcgcttcgtggccgccccggaggtg
gaatggatcctgaagcgggacgcctga

DBGET integrated database retrieval system