KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3287Help
Entry
RSP_3287          CDS       T00284                                 

Gene name
upgC
Definition
(RefSeq) carbohydrate ABC transporter ATP-binding protein, CUT1 family
  KO
K05816  sn-glycerol 3-phosphate transport system ATP-binding protein [EC:3.6.3.20]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp02010  ABC transporters
Module
rsp_M00198  Putative sn-glycerol-phosphate transport system
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RSP_3287 (upgC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsp02000]
    RSP_3287 (upgC)
Enzymes [BR:rsp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.20  glycerol-3-phosphate-transporting ATPase
     RSP_3287 (upgC)
Transporters [BR:rsp02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter [MD:M00198] [OT]
    RSP_3287 (upgC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran TOBE_2 AAA_21 SMC_N RsgA_GTPase AAA_16 AAA_29 AAA_22 AAA_23 AAA AAA_28 ATPase_2 AAA_33 NACHT AAA_30 Rad17 AAA_25 AAA_5 AAA_18 NB-ARC TOBE MMR_HSR1 AAA_14 IstB_IS21 RNA_helicase Adeno_IVa2
Motif
Other DBs
NCBI-GeneID: 3721887
NCBI-ProteinID: YP_354795
UniProt: Q3IX40
Position
2:complement(344934..345983)
Genome map
AA seq 349 aa AA seqDB search
MAEISLRDVRKSYAGIEVIHGVDFEIADGEFVVIVGPSGCGKSTLLRMVAGLEEITAGEI
AIGGRVVNRLEPRERDIAMVFQNYALYPHMTVRENMAYGLRIAKLSKAEIEERVARSATM
LELGQLLDRKPRQLSGGQRQRVAMGRALVRNPAAFLLDEPLSNLDAKLRVQMRLQIKELQ
RTVRTTSIYVTHDQVEAMTLADRLVVMNAGVAEQIATPAEIYDRPATTFVAGFIGSPAMN
MLPARGLGDALEVAGQRLAVPAPAGRDLILGVRPEHLHAAGPEEPGFELHVQAVEWLGAD
AFAHGRLADGTELVLRTPGKAPVRERDRLKVAPDAAALHLFDAETGRRL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtggcggaaatttcgctcagggacgtgcgcaagagctatgcggggatcgaggtgatccac
ggggtcgatttcgagattgcggacggcgaattcgtggtgatcgtgggcccttcgggctgc
ggcaagagcacgcttctgcgcatggttgcggggctcgaggagatcaccgcgggcgagatc
gccatcggcggccgcgtggtcaaccggctggaaccgcgcgagcgcgacatcgcgatggtg
ttccagaactacgcgctctacccccacatgacggtgcgcgagaacatggcctacggcctg
aggatcgcgaagctctcgaaggcggagatcgaggaacgggtcgcgcgctcggccaccatg
ctggaactgggccagcttctcgaccgcaagccgcgccagctgtcgggcgggcagcggcag
cgggtggcgatgggccgggcgctggtgcgcaaccccgcggccttcctgctggatgagccg
ctctcgaacctagatgcgaagctgcgggtgcagatgcgtttgcagatcaaggagttgcag
cgcactgttcgcaccacctcgatctatgtcacccacgatcaggtcgaggcgatgacgctc
gccgaccggctggtggtgatgaatgcgggcgtggccgagcagatcgccacgccggccgag
atctacgaccggcccgccaccaccttcgtggcggggttcatcggttcgcccgcgatgaac
atgctgcccgcccgaggccttggcgacgcgctggaggtggcggggcagcgtctcgccgtg
cccgcgccagcgggacgcgatctgatcctcggcgtccggcccgagcatctccatgccgcg
ggccccgaggagccgggcttcgagctccatgtgcaggcggtcgaatggctgggcgcggac
gccttcgctcatggacggctggcggacggcaccgagctcgtgctgcggaccccgggcaag
gcgccggtgcgcgagcgcgaccgactgaaggtcgcccccgatgcggcggccctgcatctc
ttcgatgcagaaaccggccggcggctctga

DBGET integrated database retrieval system