KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3288Help
Entry
RSP_3288          CDS       T00284                                 

Gene name
ugpE
Definition
(RefSeq) carbohydrate ABC transporter membrane protein 2, CUT1 family
  KO
K05815  sn-glycerol 3-phosphate transport system permease protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp02010  ABC transporters
Module
rsp_M00198  Putative sn-glycerol-phosphate transport system
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    RSP_3288 (ugpE)
Transporters [BR:rsp02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter [MD:M00198] [OT]
    RSP_3288 (ugpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF3927 NdhL
Motif
Other DBs
NCBI-GeneID: 3721888
NCBI-ProteinID: YP_354796
UniProt: Q3IX39
Position
2:complement(345984..346847)
Genome map
AA seq 287 aa AA seqDB search
MAEHEMIGTSRQSRIMAHFLLVIGVIVVAFPIWYVFVASTHPLQQILRPPLPLLPGAEGP
SNYARALGGGIGQIGRVGVDRLLLNTAVVAFGIAIGKILISMASAYAIVFFRFPLRMVCF
WMIFITLMLPVEVRILPTYKVMVDLRLIDTYAGLILPLVASATGTLLFRQFFMTIPNELM
EAARVDGAGPWRFFKDILLPLSATNIAALFVILFIYGWTQYLWPLLVTNSNSMNTIVIAL
RKMISFADADTPWDLVMVTCVLAILPPILVVVLMQRWFVKGLVETEK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcacgagatgatcggcacctcgcgccagagccggatcatggcgcatttcctg
ctggtgatcggggtcatcgtggtggccttcccgatctggtatgtcttcgtggcctcgacc
cacccgctccagcagatcctgcgcccgccgctgccgctgctgcccggcgccgaggggccc
tcgaactacgcccgcgcgctcggcggcgggatcggacagatcggccgcgtgggggtggac
cggcttcttctcaacacggccgtcgtggctttcggcatcgccatcggaaagatcctgatc
tcgatggcctcggcctacgccatcgtcttcttccgcttcccgctgcgcatggtctgcttc
tggatgatcttcatcaccctgatgctgccggtcgaggtgcggatcctgcccacctacaag
gtgatggtggacctgcgcctgatcgacacctacgcgggtctgatcctgccgctggtggcc
tcggccacggggacgctgctcttccggcagttcttcatgacgatcccgaacgagctgatg
gaagccgctcgcgtcgatggcgcaggcccctggcgcttcttcaaggacatcctgctgccg
ctctcggccaccaacatcgcggcgctgttcgtgatcctcttcatctacggatggacgcag
tatctctggccgctcctcgtgaccaactcgaactcgatgaacaccatcgtgatcgccctg
agaaagatgatctccttcgccgatgccgacacgccgtgggacctcgtgatggtcacctgc
gtgctggccatcctgccgccgatcctcgtggtcgtgctgatgcagcggtggttcgtgaag
ggacttgtggagacggagaagtaa

DBGET integrated database retrieval system