KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3291Help
Entry
RSP_3291          CDS       T00284                                 

Definition
(RefSeq) Putative Na+/phosphate symporter
  KO
K03324  phosphate:Na+ symporter
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Brite
Transporters [BR:rsp02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   RSP_3291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_Pi_cotrans PhoU Protoglobin
Motif
Other DBs
NCBI-GeneID: 3721991
NCBI-ProteinID: YP_354799
UniProt: Q3IX36
Position
2:complement(349263..350957)
Genome map
AA seq 564 aa AA seqDB search
MSPLPPTVQFIDLLAAAALLLWGLRLIRTGVMRAFGATLRQWISRATSNRVVAALWGLLA
TLGLQSSTATAVITGSFAARGIMTAPMAQAVMLGANLGTATVAALLSVDVHWVASLCILA
GVVGFSMARATRGRGIGRALLGLGLMLLALRLMGEVTAPLQHSRTLALVIAGLGEAPLVA
ALLAAGLAVLSASSLAVVLLVMVLAGGGLIETVPALALVAGANVGGAVTPWLAVAAEGPA
ARRITLGNLAVRIAGAALVLLFAAPLADLLDEAVSDHGQRVIAAHLAFSAVLLLLFLPLV
GPLCRLVERFLPDPPEGRRGAAFLDESLLDTPAMALAVAARETLRVGDLVGEMLERSRQA
LLANDEFAAQEVSRLEPDIDRLTEAIKLYITRLSRAELDEDDVRRANEITSFAINLEHMG
DIIETGLADAALKKIRKRLAFSPEGGAELAEVHERTVANLRLAQAVFLGRDADLARQLVE
SKIEIRRLEALSSERHLGRLRAGRPEAMETSTIHLDLLRDLKRLNAHLTSVAHPILTEIG
VLRESRMRSLSSGRNLAEPVGPER
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccattgccgccgaccgttcagttcatcgatcttcttgccgcggccgcgctgctg
ctctggggcctgcggctgatccgcaccggcgtcatgcgcgccttcggggccacgttgcgg
caatggatctcacgcgccaccagcaaccgggtcgtggcggcgctctggggcctgcttgcg
acgctcggcctgcagtcgagcacggccacggcggtcatcaccggctcgttcgcggcccgt
ggcatcatgacggcgccgatggcgcaggcggtgatgctgggggcgaacctcggcaccgcg
acggtggcggcgctcctgtcggtcgatgtccattgggtggcgagcctctgcatccttgca
ggcgtcgtgggtttctcgatggcgcgtgccacccgcggccgcggcatcgggcgggcgctc
ctcggcctcgggctgatgctgctcgccctgcggctgatgggcgaggtgacggcgccgctc
cagcattcccgcacgctcgcgctggtgatcgcaggcctcggcgaggcgccgctggtggcg
gctctccttgccgcgggcctcgccgtcctcagtgcctcctcgcttgccgtcgtgctcctc
gtcatggtgctggcgggcggcggtctcatcgagacggtgccggctctagccctcgtggcg
ggcgcgaacgtcggcggcgcggtcacgccctggctcgccgtggcggccgaggggccggcg
gcgcggcggatcacgctcggcaacctcgcggtgcggatcgcgggggcagccctcgtgctg
ctcttcgccgcgcctctggcggaccttctcgacgaggccgtctccgatcacggccagcgg
gtcatcgcggcgcatctggccttcagcgcggtgctcctcctcctgttcctgcccctcgtg
ggtccgctctgccgcctcgtcgagcggttcctgcccgatccgccggagggccggcgcggc
gcggccttcctcgacgagagcctgctcgacacgcccgccatggcgctcgccgtcgccgcg
cgcgagactctgcgggtgggcgacctcgtgggcgagatgctcgagcgcagccggcaggcg
ctgctggccaatgacgaattcgcggcgcaggaggtctcgcggctcgagcccgacatcgac
cggctgaccgaggcgatcaagctctatatcacccgcctctcgcgcgccgagctggacgag
gacgatgtgcggcgtgcgaacgagatcacctcctttgccatcaatctcgaacatatgggc
gacatcatcgagaccgggctcgccgatgcggcgctgaagaagatccgcaagcgcctcgcc
ttttcgccggagggcggcgcggaactggccgaggtgcatgagcgcacggtggcgaacctg
cggctggcgcaggcggtgttcctcgggcgggatgccgatctcgcccggcagctcgtcgag
tcgaagatcgagatccggcggctcgaggcgctgtcctccgaacgccacctcggccggttg
cgggccgggcggcccgaagcgatggagacgagcaccatccatctcgatctgctgcgcgac
ctcaagcggctgaacgcccatctcacctcggtcgctcacccgatcctgaccgagatcggc
gtgctccgcgaaagccggatgcgcagcctgagttccggccgcaatctggccgagcccgtc
ggtcccgaacgctaa

DBGET integrated database retrieval system