KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3294Help
Entry
RSP_3294          CDS       T00284                                 

Definition
(RefSeq) amino acid/amide ABC transporter membrane protein 1, HAAT family
  KO
K01997  branched-chain amino acid transport system permease protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp02010  ABC transporters
rsp02024  Quorum sensing
Module
rsp_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    RSP_3294
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    RSP_3294
Transporters [BR:rsp02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    RSP_3294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-GeneID: 3721995
NCBI-ProteinID: YP_354802
UniProt: Q3IX33
Position
2:complement(353621..354508)
Genome map
AA seq 295 aa AA seqDB search
MMTIFGIPTAALFGQLLVGLINGSFYALLSLGLAVIFGLLRVINFAHGAQYMAGAFAALL
LLTQTGIGYWPALILAPLIVGLGGALIERTMLSRLYKLDPLYGLLFTFGLALTLEGTFRW
FFGTSGQPYSPPAALTGAVNLGFMFLPIYRGWVVVASLAVCLGVWLLIEKTKLGAYLRAA
TENPVLVQSFGVNVPLLLTFTYGLGAALAGFAGVLAAPVYQVSPLMGSNLIIVVFAVVVV
GGMGSILGAIVTGYLLGIAEGLTKVFYPEASNIVIFVIMAIVLILRPAGLFGKDA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgatcttcggcattccgacggcggccctcttcggccagctgctggtgggtctc
atcaacggctcgttctatgcgctcctgtcgctggggcttgcggtgatcttcggccttctc
cgggtcatcaacttcgcccatggcgcgcaatatatggccggcgccttcgcggcgctcctc
ctgctcacccagaccgggatcggctactggcccgcgctgatcctcgccccgctcatcgtg
ggtctgggcggcgcgctgatcgagcgcaccatgctctcgcggctctacaagctcgacccg
ctctacgggctgctcttcaccttcggccttgcgctcacgctcgaaggcacgttccgctgg
ttcttcggcacctcgggccagccctattcgccgccggccgcactgaccggagcggtcaat
ctcggcttcatgttcctgccgatctatcgcggctgggtggttgtggcctcgctcgccgtc
tgcctcggcgtctggcttctgatcgaaaagacgaagctcggcgcctatctgcgggccgcg
acggaaaatccggtgctggtccagagcttcggggtcaatgtgccgctgcttctgaccttc
acctacgggctgggcgcggcgctcgcgggctttgcgggcgtgctggccgcgccggtctat
caggtctcgccgctcatggggtcgaacctcatcatcgtcgtcttcgcggtcgtcgtggtg
ggaggcatgggctcgatcctcggcgcgatcgtgaccggctatctgctcggcatcgccgag
gggctcaccaaggtcttctatcccgaggcctcgaacatcgtgatcttcgtcatcatggcg
atcgtcctgatcctgcggcctgcgggactcttcggaaaggatgcgtga

DBGET integrated database retrieval system