KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3296Help
Entry
RSP_3296          CDS       T00284                                 

Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K01995  branched-chain amino acid transport system ATP-binding protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp02010  ABC transporters
rsp02024  Quorum sensing
Module
rsp_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RSP_3296
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RSP_3296
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsp02000]
    RSP_3296
Transporters [BR:rsp02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    RSP_3296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 BCA_ABC_TP_C SMC_N AAA_23 AAA_15 AAA_27 AAA_29 SRP54 AAA_22 AAA_30 AAA_33 RsgA_GTPase Zeta_toxin AAA_5 Thymidylate_kin
Motif
Other DBs
NCBI-GeneID: 3721997
NCBI-ProteinID: YP_354804
UniProt: Q3IX31
Position
2:complement(355205..355978)
Genome map
AA seq 257 aa AA seqDB search
MAPVTDHEPRVVLSARGLGKDFGGFTAVNNVDLDVHHARIHALIGPNGAGKTTVFNLLTK
FLQPTRGKITLLGTDITRTRPDKVARMGMVRSFQISAVFPHLTVLENVRVALQRPAELAV
QFWQPLSALDRLNGRAEVLIEELGLTPYLNTRAADLSYGRKRVLEIATTLALDPEVLLLD
EPMAGMGQEDVQMVAGIIREVARHRAVLMVEHNLNVVADICHQVTVLQRGEILAHGDYAT
VSTDPRVRTAYMGTEDA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggtcacagaccacgagccgcgggtggtgctgtccgcccgcggcctcgggaag
gatttcggcggcttcacggccgtcaacaatgtggatctcgatgtccatcacgcgcggatc
catgcgctgatcggaccgaacggagcgggaaagaccaccgtcttcaacctgttgacgaag
tttcttcaaccgacccgcggcaagatcaccctgctcgggacggacatcacccgcacgcgc
cccgacaaggtggcgcggatgggaatggtgcgctcgttccagatctcagcggtcttcccg
catctgacggtgctcgagaatgtgcgcgtggcgctccagcgcccggccgagctcgcggtg
cagttctggcagccgctttcggcgctcgaccggctgaacggccgggccgaggtgctgatc
gaggaactggggctcacgccctacctcaacacgcgtgcggcggatctttcctatgggcgc
aagcgcgtgctggagatcgcgaccaccctcgccctcgatcccgaggtcctgcttctcgac
gagccgatggccggcatgggccaggaggatgtgcagatggtggcgggcatcatccgcgag
gtggcccgccaccgggcggtgctgatggtcgagcacaatctgaacgtcgtcgccgacatc
tgccatcaggtgacggtgctgcagcggggcgagatcctcgcccacggcgactatgccacc
gtgagcaccgatccgcgcgtgcgcacggcctatatgggaacggaggacgcatga

DBGET integrated database retrieval system