KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3323Help
Entry
RSP_3323          CDS       T00284                                 

Definition
(RefSeq) Putative flavoprotein containing monooxygenase involved in K+ transport
  KO
K07222  putative flavoprotein involved in K+ transport
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    RSP_3323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_3 FMO-like Pyr_redox_2 K_oxygenase FAD_binding_3 NAD_binding_8 NAD_binding_7 SnoaL_2 IlvN FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 3722023
NCBI-ProteinID: YP_354827
UniProt: Q3IX08
Position
2:385161..386963
Genome map
AA seq 600 aa AA seqDB search
MLDQSESLALASLVAELERALVAQDAEAVADCFLETGFWRDLAAFTWNIKTCEGKGEIRA
MAGAQLGAIGPQALALDPAETVSSADGVTEGWLTFETATGRGMGHIRMKDGKVWTLLTAL
HELKGHEEPRRLRRPMGAEHGHDPHRKTWKEKREEEARRLGYEEQPYVLIVGGGQGGIAL
GARLRQLGVPTIILEKNERPGDSWRRRYKSLCLHDPVWYDHLPYIPFPDNWPVFAPKDKI
GDWLEMYTKVMELNYWSSSTARSARYEEAAGEWTVVVDRNGEEVVLRPKQLVLATGMSGK
ANVPSFPGQDIFRGEQQHSSQHPGPDAYKGKKVVVIGSNNSAHDICAALWEGGADVTMVQ
RSSTHIVKSDSLMEVCLSGLYSEQAVAQGIDHEKADMIFASVPYRIMHEFHIPQYEEIQR
RDADFYDALRKAGFLLDFGDDGSGLFMKYLRRGSGYYIDVGACDLVIDGSIKLKSGSDVS
HLTEEAVVLKDGTELPADLVVYATGYGSMNGWAADLISPEVADKVGKCWGLGSDTTKDPG
PWEGEQRNMWKPTMQEALWFHGGNLHQSRHYSRYLALQLKARQAGIETPVWGLQPPSHLR
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatcaaagtgaaagtctggcgctcgcgtcgctggtggcagagctcgaacgggcg
ctggtggcgcaggacgcggaggcggtcgcggactgtttcctcgagaccgggttctggcgc
gacctcgcggccttcacctggaacatcaagacctgcgagggcaagggcgagatccgcgcc
atggccggcgcccagctcggggccatcggccctcaggcgctcgcgctcgatccggccgag
acagtcagttcggcggacggggtcacggagggctggctcaccttcgagacggcgaccggc
cgcggcatgggccacatccgcatgaaggacggcaaggtctggacgctcctgactgcgctc
catgagctgaaggggcacgaggagccgcgccgcctgcgccggccgatgggggccgagcac
ggccacgatccgcaccgcaagacctggaaggagaagcgcgaggaggaggcgcggcgactg
ggctacgaggagcagccctatgtcctcatcgtgggcggcggtcagggcgggatcgcgctt
ggcgcgcggctgcgccagctcggggtgcccacgatcatcctcgagaagaacgagcggccc
ggcgacagctggcggcggcgctacaagtcgctctgcctgcatgacccggtctggtatgac
cacctgccctacatccccttcccggacaactggccggtcttcgcgccgaaggacaagatc
ggtgactggctcgagatgtatacgaaggtgatggagctgaactactggtcctcgagcacg
gcgagatccgcccgctacgaagaggccgcgggcgagtggacggtggtcgtcgaccgcaac
ggcgaggaggtggtgctgcgcccgaagcagctcgtgctcgccaccggcatgtcgggcaag
gccaacgtgccgagcttcccgggacaggacatcttccgcggcgagcagcagcattcgagc
cagcatcccggccccgacgcctacaagggcaagaaggtggtggtgatcggctcgaacaac
tcggcgcacgacatctgcgcggctctgtgggagggcggggccgatgtcacgatggtgcag
cggtcctcgacccatatcgtgaagtcggacagcctgatggaggtctgcctctcggggctc
tattccgagcaggcggtggcgcagggcatcgaccacgaaaaggccgacatgatcttcgcc
tcggtgccctaccggatcatgcacgagttccacatcccgcagtatgaggagatccagcgc
cgcgacgccgacttctacgacgcgctgcgcaaggcgggcttccttctcgacttcggcgac
gacggttcgggcctgttcatgaaatacctgcgccgcgggtcgggctactacatcgatgtg
ggcgcctgcgatctggtcatcgacggctcgatcaagctgaagtcgggctcggacgtgagc
cacctcaccgaagaggcggtggtgctgaaggacggcaccgagctgccggcggatctggtg
gtctatgccacgggctatggctcgatgaacggctgggccgcagatctcatcagcccggaa
gtggccgacaaggtgggcaaatgctggggcctcggttccgacacgaccaaggatcccggc
ccctgggagggcgaacagcgcaacatgtggaagcccacgatgcaggaggcgctctggttc
cacggcggcaacctgcatcagtcgcgccactattcgcgctacctcgcgctgcagctgaaa
gcccggcaggccgggatcgagacgcccgtctggggcctccagcctcccagccacctgcgc
tga

DBGET integrated database retrieval system