KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3325Help
Entry
RSP_3325          CDS       T00284                                 

Definition
(RefSeq) Polysaccharide export transporter, PST Family
  KO
K03328  polysaccharide transporter, PST family
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_synt_3 Polysacc_synt
Motif
Other DBs
NCBI-GeneID: 3722025
NCBI-ProteinID: YP_354829
UniProt: Q3IX06
Position
2:388498..390003
Genome map
AA seq 501 aa AA seqDB search
MTADPSPFDPPEGALRATASRGAVATVISQGALMLTQIGSVVILSRLLSPEDFGLVAMCT
PVIALLMMLQDFGLLAATVQKKGLKAEEVNFLFWINVALSFSLTILLLAASPLIALFYQE
PRVGPLIAALSVTIALNGLGAQHGALLIRRMQYVRLGFIQVSGAVTSLAAAALWGWIHPS
PWALFGGALVGTVVPTLGMWIGSRWRPGLPRRIEGWRPLLNFGAGVTGFNFANFFSMNVD
KIAIGRAFGGEALGYYDRAFKLVLMPSNSIFNPLARVMVPALSRLQDEPDRYRSAYIRVA
GLLLFLLLPMMACAAAFADVVIPLAFGQNWDGSVAIFTALGIAGLVQPLNNVAGWLFLSQ
GRSRDFFHSGLIHAGFAGVAVLAGLPFGLIGVVVAVAIAEYLKLPAIWALTCRSGPIRLG
DMLRGVGPLVAAVHLVMGLLWVIKPYVPGPGFVALVQGGLLAYALTALLISLTASGRQTL
REGWRLAGERLPLRRRLPADA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtgactgccgatccgagccccttcgatccgccggaaggcgccctccgcgcgacggccagc
cggggggcggtggccaccgtgatctcgcagggcgcgctgatgctcacgcagatcggatcg
gtcgtgatcctctcgcggcttctgtcgcccgaggatttcggcctcgtcgccatgtgcacg
ccggtgatcgcgcttctgatgatgctgcaggatttcggcctgctggcagccaccgtccag
aagaaggggctgaaggcggaagaggtcaatttcctcttctggatcaacgtggcgctgagc
ttctcgctcacgatcctgcttctggccgcctcgcccctcatcgcgctcttctatcaggag
ccgcgggtggggccgttgatcgccgcgctctccgtcaccatcgccctgaacggcctcggc
gcgcagcacggggcccttctgatccggcggatgcaatatgtgcggctgggtttcattcag
gtctcgggcgccgtgacctcgcttgccgccgcagctctctggggctggatccacccgagc
ccctgggcgctcttcggcggggctctggtgggcaccgtggtgcccacgctcggcatgtgg
atcggctcgcgctggcggccgggcctgccgcggcggatcgagggctggcggccgctcctc
aacttcggggcgggcgtcacgggcttcaatttcgccaacttcttctcgatgaacgtggac
aagatcgcgatcggccgcgccttcgggggcgaggcgctgggctactacgaccgcgccttc
aagctggtgctgatgccctcgaactcgatcttcaatcctctggcgcgggtgatggtgccc
gccctctcgcggcttcaggacgaacccgaccgctaccgcagcgcctatatccgggtggcg
gggcttctgctgttcctgctgctgccgatgatggcctgcgccgcggccttcgccgacgtg
gtcatcccgctggccttcggccagaactgggacggcagcgtggccatcttcaccgcactc
ggcatcgcggggctggtgcagccgctgaacaatgtcgcgggctggctcttcctcagccag
ggacgctcgcgcgacttcttccattccggcctcatccatgcgggcttcgcgggcgtcgcg
gtgctggcgggcctgcccttcggcctgatcggcgtggtggtggccgtggcgatcgccgaa
tatctcaagctgcccgcgatctgggcgctcacctgccgcagcggcccgatccgcctcggc
gacatgctgcgcggcgtggggccgctggtggcggccgtccatctcgtgatggggctcctg
tgggtcatcaagccctatgtcccgggcccgggcttcgtcgcgctggtgcagggcggcctt
ctggcctatgcgctcaccgccctcctgatctcgctcaccgcctcgggccgccagaccctg
cgcgagggctggcggcttgcgggcgagcggctgcctctgcgccgccgcctgcccgccgac
gcctga

DBGET integrated database retrieval system