KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3326Help
Entry
RSP_3326          CDS       T00284                                 

Definition
(RefSeq) Low molecular weight phosphotyrosine protein phosphatase
  KO
K01104  protein-tyrosine phosphatase [EC:3.1.3.48]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Brite
Enzymes [BR:rsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     RSP_3326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LMWPc
Motif
Other DBs
NCBI-GeneID: 3722026
NCBI-ProteinID: YP_354830
UniProt: Q3IX05
Position
2:complement(390017..390490)
Genome map
AA seq 157 aa AA seqDB search
MSLLPSVLFVCLGNICRSPLAEAAFRAAADERGLRLTVDSAGLGGWHAGEAPDPRAQEVA
RANGIDISHYRARQVARKDFGLFDHVVALDLDNLVALRELRPQSARARLSLLLDHVPGRE
GQAVSDPYYSGPEGFLTTWSDVTAGADGLLTKILAPA
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttcttccctccgtcctcttcgtctgcctcggcaacatctgccgctcgccgctc
gccgaggccgccttccgcgccgctgcggacgagcgcggcctccgcctcaccgtcgacagc
gcgggcctcggcggctggcatgcgggcgaggcgcccgatccgcgcgcgcaggaggtggcg
cgcgcgaacggcatcgacatcagccattaccgcgcccgtcaggtggcaaggaaggatttc
ggcctgttcgatcatgtcgtggcgctcgacctcgacaatctggtggcgctgcgcgaactg
cgcccgcagagcgcccgggcgcgactgtcgctcctgctcgaccatgtgccggggcgggag
ggacaggccgtgtcggatccctattacagcggtcccgaagggttcctcaccacctggtcg
gatgtcaccgccggggcggacgggctgctcacgaagatcctcgccccggcctga

DBGET integrated database retrieval system