KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3337Help
Entry
RSP_3337          CDS       T00284                                 

Definition
(RefSeq) ABC spermidine/putrescine transporter, periplasmic binding protein
  KO
K02055  putative spermidine/putrescine transport system substrate-binding protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp02024  Quorum sensing
Module
rsp_M00193  Putative spermidine/putrescine transport system
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RSP_3337
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsp02000]
    RSP_3337
Transporters [BR:rsp02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putative spermidine/putrescine transporter [MD:M00193]
    RSP_3337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 TAT_signal SBP_bac_6 Voltage_CLC
Motif
Other DBs
NCBI-GeneID: 3722038
NCBI-ProteinID: YP_354842
UniProt: Q3IWZ3
Position
2:complement(400685..401950)
Genome map
AA seq 421 aa AA seqDB search
MKKNHYSRRTLLKGAAAAGLASAFPAPMIWAQDIKDITLRQFGTGVSNLNEVAQKVKEDL
GFTLTMTALDSDAVTQRAATQPDSFDIADIEYWICKKVWPTGNLQAMDTSKIKNYDKIVG
IFRSGKLTPESTIAQGTAPHTVGFTSGPGGTDFVQEESGWMTLIPTIYNADTLGIRPDLI
GRPIESWTELLNPEFKGKASILDISSIGIMDAAMVCEAMGEITYGDKGNMTREEIDRTMA
IFTEAKKAGQFRAFWKTFDESVNLMASGEVVIQSMWSPAITAVKSRGIPCVYQPLREGYR
SWGGGIGLSARLDGLALEAAYEYINWYLSGWVGGFLMRQGYYSAVPETSKEFMSENEWGY
WFEGKPATDTITNPQGQAMAQAGEVRDGGSFEERMGRVACWNSVMDENQYMVRKWNEFIA
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaaccattacagccgccggacgctgctcaagggcgcggcggccgcgggcctg
gcctcggcctttcccgcaccgatgatctgggcgcaggacatcaaggacatcacgctgcgc
cagttcggcaccggcgtgtcgaacctcaacgaggtggcgcagaaggtgaaggaggatctg
ggcttcaccctcaccatgaccgcgctcgacagcgacgcggtgacccagcgcgcggcgacc
cagcccgacagtttcgacatcgccgacatcgaatactggatctgcaagaaggtctggccg
acgggcaacctgcaggcgatggatacgtcgaagatcaagaattacgacaagatcgtgggc
atcttccgctcgggcaagctcacgcccgagagcaccatcgcgcagggcaccgcgccgcat
accgtgggcttcacctccggtcccggcggcacggatttcgtgcaggaagagtcgggctgg
atgacgctcatccccacgatctacaatgccgacacgctgggcatccgccccgacctgatc
ggccgcccgatcgaaagctggaccgagcttctgaaccccgagttcaagggcaaggcctcg
atcctcgacatctcctccatcggcatcatggatgcggccatggtctgcgaggcgatgggc
gagatcacctacggcgacaagggcaacatgacccgcgaagagatcgaccgcaccatggcg
atcttcaccgaggccaagaaggcgggccagttccgcgccttctggaagaccttcgacgag
agcgtgaacctgatggcctcgggcgaggtggtgatccagtcgatgtggtcgcccgccatc
acggcggtgaagtcgcgcggcattccctgcgtctaccagccgctcagggaaggctaccgc
tcgtggggcggcggcatcggcctgtcggcgcggctcgacggtctcgcgctggaggcagcc
tacgaatatatcaactggtatctctcgggctgggtcggcggcttcctcatgcggcagggc
tattattccgccgtgcccgagacctcgaaggagttcatgtccgagaacgaatggggctac
tggttcgagggcaagcccgccaccgacacgatcaccaacccgcagggtcaggccatggcg
caggcgggcgaggtgcgcgacggcggctcgttcgaggagcgcatgggccgcgtcgcctgc
tggaactcggtgatggacgagaaccagtacatggtccgcaagtggaacgagttcatcgcg
gcctga

DBGET integrated database retrieval system