KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3338Help
Entry
RSP_3338          CDS       T00284                                 

Definition
(RefSeq) ABC spermidine/putrescine transporter, ATPase subunit
  KO
K02052  putative spermidine/putrescine transport system ATP-binding protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp02024  Quorum sensing
Module
rsp_M00193  Putative spermidine/putrescine transport system
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    RSP_3338
Transporters [BR:rsp02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putative spermidine/putrescine transporter [MD:M00193]
    RSP_3338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran TOBE_2 AAA_21 ABC_ATPase AAA_16 RsgA_GTPase AAA_28 TOBE AAA AAA_22 AAA_5
Motif
Other DBs
NCBI-GeneID: 3722039
NCBI-ProteinID: YP_354843
UniProt: Q3IWZ2
Position
2:complement(401976..402953)
Genome map
AA seq 325 aa AA seqDB search
MRTGHDLELVHVTKRYGGSAVAVADVSHLFVGGSYVCLLGPSGCGKSSTLRMIAGHETVS
EGSILLSGKDVTRLPPARRGTAMMFQSYALFPHLSVTDNVAFSLKMKGVEAAQRRAKAAE
MLELVDMGRYADRLPAQLSGGQQQRVALARALITGPQVLLLDEPLSALDPFLRIRMRAEL
KRLQRELGISFIHVTHGQDEALALADEIVVMNNAKIEQAGPARDVFNAPRTEFVARFMGG
HNVVALPQGRFALRCDEIRLDPAGQEAVVQAVEYQGAHVALTLRAAGDQELVALIPEATF
FEQPKNPGESVHLAWDEGRMHRLQA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcggaccggacacgatctcgaactcgtgcatgtgacgaagcgctacggcggctcggcc
gtagcggtcgcggatgtgagccaccttttcgtggggggcagttacgtctgcctcctcggg
ccctcgggctgcggcaaatcctcgaccctgcggatgatcgcgggccacgagacggtgagc
gagggctcgatcctcctgtcgggcaaggatgtgacgcggctgccgcccgcgcgccgcggc
acggcgatgatgtttcagagctacgcgctctttccgcatctgtcggtgacggacaatgtg
gccttctcgctgaagatgaagggggtggaggccgcccagcgccgggcgaaggcggccgag
atgctcgagctcgtcgacatgggccgctatgcggacaggctgcccgcgcagctctcgggc
ggccagcagcagcgcgtggcgctggcgcgcgcgctcatcaccgggccgcaggtgctgctg
ctcgacgagcccttgtcggcgctggatccgttcctccgcatccggatgcgggctgagctg
aagcggcttcagcgcgagctcgggatctccttcatccatgtcacccacgggcaggacgag
gcgctggccttggccgacgagatcgtggtgatgaacaacgccaagatcgagcaggcgggc
cccgcgcgcgacgtcttcaacgcgccccgcaccgagttcgtggcccgcttcatgggcggg
cacaatgtggtggcgctgccgcagggccgcttcgcgctgcgctgcgacgagatccgtctc
gacccggccgggcaggaggccgtggtgcaggcggtggaatatcagggcgcgcatgtggcg
ctgaccctgcgggccgccggagatcaggagctcgtggccctgatccccgaggcgaccttc
ttcgagcaaccgaaaaacccgggcgagtccgtgcacctcgcctgggacgaggggcggatg
caccgccttcaggcctga

DBGET integrated database retrieval system