KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3339Help
Entry
RSP_3339          CDS       T00284                                 

Definition
(RefSeq) transcriptional regulator, GntR family
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FCD GntR HTH_Crp_2 TFIIE_alpha HTH_41
Motif
Other DBs
NCBI-GeneID: 3722040
NCBI-ProteinID: YP_354844
UniProt: Q3IWZ1
Position
2:403165..403878
Genome map
AA seq 237 aa AA seqDB search
MEMRGSMTEDAAALAGGGNDTVAGRLALAIHEHRIQPGTKLAEDELGEIFGVSRTLVRAA
LQQLAHERLVTLRRNRGAFVAQPSVREAREVFEARALLEPRTARSAAERATAADIARLQR
HIDEEHAALDAGDPGRALRLSGQFHIEVAVIADQDTIRDFVAQLVARSSLIIALYWQRRT
ALCESHAHHALLRALADGDGARAEEMMKGHLLDLVSSLDLRNPAPPARSLREALDRI
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggagatgcgaggcagcatgacagaggacgcggcggcgcttgcgggcgggggcaacgac
acggtggcgggccgtctcgcgcttgcgatccacgagcaccggatccagcccggcacgaaa
ctcgcggaagacgagctgggcgagatcttcggggtgagccggacgctggtgcgcgcggcg
ctgcagcagcttgcgcacgagcggctggtgacgctgcggcgcaaccgcggcgccttcgtg
gcccagccttcggtgcgcgaggcgcgcgaggtgttcgaggcccgcgccctgctcgagccg
cgcaccgcccgctcggccgcggaacgggccacggccgcggacatcgcccggctgcagcgt
catatcgacgaggaacatgccgcgctcgatgcgggcgatccggggcgcgccctgcgcctc
tcgggccagttccacatcgaggtcgcggtcatcgccgatcaggacacgatccgcgacttc
gtggcccagctcgtcgcgcgatcctcgctcatcatcgcgctctactggcagcgccgcacc
gcgctctgcgaaagccacgcccaccatgcgctcctgcgggcgctggccgacggcgacggg
gcccgcgccgaggagatgatgaagggccacctcctggatctcgtctcatcgctcgacctg
cgcaatcccgcgccgcccgcccggtcgctgcgcgaggcgctcgaccggatctga

DBGET integrated database retrieval system