KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3346Help
Entry
RSP_3346          CDS       T00284                                 

Definition
(RefSeq) methionine synthase (B12-dependent)
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00270  Cysteine and methionine metabolism
rsp00450  Selenocompound metabolism
rsp00670  One carbon pool by folate
rsp01100  Metabolic pathways
rsp01110  Biosynthesis of secondary metabolites
rsp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RSP_3346
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    RSP_3346
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    RSP_3346
Enzymes [BR:rsp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     RSP_3346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Met_synt_B12 Pterin_bind B12-binding_2 B12-binding CdhD
Motif
Other DBs
NCBI-GeneID: 3722047
NCBI-ProteinID: YP_354851
UniProt: Q3IWY4
Position
2:complement(411187..413913)
Genome map
AA seq 908 aa AA seqDB search
MTRYLRLSGLEPFVLTPDIPFVNVGERTNVTGSARFRKLITNRDYAAALEVARDQVQNGA
QILDVNMDEGLIDSKAAMVEFLNLIASEPDIARVPLMIDSSKWEVIEAGLKCVQGKPVVN
SISLKEGEESFRRQAGLCLAYGAAVVVMAFDEEGQADSFARKTTICARAYRILVEEVGFP
PEDIIFDPNVFAVATGIEEHDNYGVDFIEAARWIRANLPHAHVSGGVSNLSFSFRGNEPV
REAMHAVFLYHAIRAGMDMGIVNAGQLAVYDQIDPDLREACEDVVLNRKPKQGGTATERL
LALAERFRGGAREEKTRDLAWRGWPVEKRLEHALVNGITEFIEADTEEARQAAERPLHVI
EGPLMAGMNVVGDLFGAGKMFLPQVVKSARVMKQAVAVLLPYMEEEKRLGGGEGREAAGK
VLMATVKGDVHDIGKNIVGVVLACNNYEIIDLGVMVPPAKILEVARAEKVDAIGLSGLIT
PSLDEMVTVAAEMEREGFDIPLLIGGATTSKVHTAVKIAPSYCRGPAVYVTDASRAVGVV
GQLLSAERKGAYVEGLRADYAEVAERHARSERAKQRLPLAAARANALKLDWAAHRPVRPS
FTGSRTVDGWDLAEIARYIDWTMFFQTWELKGVYPRILEDPAQGEAARALFADAQEMLAR
IVAERWFTPRAVVGFWPANAVGDDIRLYADETRQAELATFFTLRQQVTKREGRPNLALSD
FVAPEGAGPDWVGGFVVTAGPEEASIAERFDRANDNYSAIMVKALADRFAEAMAERLHER
VRRELWGYAPDESFTPDALHAEPYRGIRPAPGYPAQPDHTEKVTLFRLLDATAATGVELT
ESMAMWPGSSVSGLYIGHPDAYYFGLARVERDQAEDYARRKGMELAEVERWLAPVMAGRV
DTPSSRAA
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgacccgttaccttcgtctctcgggcctcgagcccttcgtcctcacgcccgacatcccc
ttcgtcaacgtgggcgagcggacgaacgtcacgggctccgctcgcttccgcaagctcatc
accaaccgcgactatgcggcggcgctcgaggtcgcgcgcgatcaggtgcagaacggcgcg
cagatcctcgacgtgaacatggacgaggggctgatcgactcgaaggccgccatggtcgaa
ttcctcaacctgatcgcgtccgagcccgacatcgcgcgggtgccgctgatgatcgacagc
tcgaaatgggaggtgatcgaggccggactgaaatgcgtgcagggcaagcccgtggtcaat
tcgatcagcctgaaggagggcgaggagtcgttccggcggcaggcgggcctctgcctcgcc
tacggggccgcggtcgtggtcatggccttcgacgaggaggggcaggccgacagtttcgcc
cgcaagaccacgatctgcgcccgggcctaccgcatcctcgtcgaggaggtgggcttcccg
cccgaggacatcatcttcgacccgaacgtcttcgccgtggccacgggcatcgaggagcac
gacaattacggcgtcgacttcatcgaggccgcgcgctggatccgggcgaacctgccccat
gcccatgtctcgggcggcgtgtcgaacctctccttcagcttccgcggcaacgagcccgtg
cgcgaggcgatgcatgcggtcttcctctaccatgcgatccgggccgggatggacatgggg
atcgtgaatgcgggccagcttgcggtctacgaccagatcgatcccgacctgcgcgaggcc
tgcgaggatgtggtgctgaaccgcaagccgaagcagggcggcaccgcgaccgagcggctc
ttggctctggccgagcggttccggggcggcgcgcgcgaggagaagacgcgcgatctggcc
tggcgcggctggccggtcgagaagcggctcgaacatgcgctggtcaacggcatcaccgaa
ttcatcgaggccgacaccgaagaggcccggcaggcggccgagcggccgctccatgtgatc
gagggcccgctgatggcggggatgaacgtggtgggcgacctcttcggcgcgggaaagatg
ttcctgccgcaggtggtgaagtcggcccgggtgatgaagcaggccgtggccgtgctcctg
ccctacatggaggaggagaaacgtctcggcggcggcgagggccgcgaggcggcgggcaag
gtgctgatggccacggtgaagggcgatgtgcatgacatcggcaagaacatcgtgggcgtg
gttctcgcctgcaacaattacgagatcatcgatctgggcgtgatggtgccgccggcgaag
atcctcgaggtggcgcgggccgagaaggtggatgcgatcggcctctcgggcctcatcacg
ccctcgctcgacgagatggtgacggtggcggccgagatggaacgggaagggttcgacatc
ccgctgctgatcggcggggccactacctcgaaggtgcatacggcggtgaagatcgccccc
tcctattgcaggggccccgcggtctatgtcaccgatgcaagccgcgcggtgggggtggtg
ggccagcttctgagcgccgagcgcaagggcgcctatgtcgaggggctgcgcgccgactat
gccgaggtggccgagcgccacgcccggtcggaacgcgccaagcagcgcctgccgctggcg
gcggcgcgggccaatgcgctgaagctcgactgggccgcgcaccggccggtgcggccgagc
ttcaccggcagccggaccgtcgacggctgggatctggccgagatcgcgcgctacatcgac
tggacgatgttcttccagacctgggagttgaagggggtctatccgcgcatcctcgaggat
ccggcgcagggcgaggccgcccgcgcgctctttgccgatgcgcaggagatgctcgcgcgc
atcgtggcggaacgctggttcacgccgcgtgcggtggtgggcttctggcccgccaatgcg
gtgggcgacgacatccgcctctatgccgacgagacgcggcaggccgagctcgccaccttc
ttcaccctccgccagcaggtcacgaagcgcgaagggcggcccaatctcgccctgtcggat
ttcgtggcgcccgaaggcgcggggcccgactgggtcggcgggttcgtggtgacggccggc
cccgaggaggcctccatcgccgagcggttcgaccgggcgaacgacaattactccgccatc
atggtcaaggcgctggccgaccgcttcgccgaggccatggccgagaggctgcacgagagg
gtgcgccgcgagctctggggctacgcccctgacgagtccttcacgcccgatgcgcttcat
gccgagccctaccgcggcatccggcccgcgccgggctacccggcccagcccgaccatacc
gagaaggtcacgctcttccgcctgctcgacgcgaccgcggccacgggggtggaactgacc
gagagcatggccatgtggccgggctcgtcggtctctggcctctatatcggccatcccgac
gcctattacttcggcctcgcgcgggtcgagcgcgatcaggccgaggattatgcccgtcgc
aagggcatggaactggccgaggtcgagcgctggctcgccccggtcatggcgggccgggtc
gacacaccctcttcgcgggccgcctga

DBGET integrated database retrieval system