KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3347Help
Entry
RSP_3347          CDS       T00284                                 

Definition
(RefSeq) methionine synthase (B12-dependent)
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00270  Cysteine and methionine metabolism
rsp00450  Selenocompound metabolism
rsp00670  One carbon pool by folate
rsp01100  Metabolic pathways
rsp01110  Biosynthesis of secondary metabolites
rsp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RSP_3347
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    RSP_3347
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    RSP_3347
Enzymes [BR:rsp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     RSP_3347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans
Motif
Other DBs
NCBI-GeneID: 3722048
NCBI-ProteinID: YP_354852
UniProt: Q3IWY3
Position
2:complement(413910..414989)
Genome map
AA seq 359 aa AA seqDB search
MKPFPLWSPLLLLIRPDSMLTFSLPPSRAVPALEALVRQRILILDGAMGTQIQALGLSEE
DYAGCGCRHHAERPQKGNNDLLILTQPQAIEEIHFRYAMAGADIVETNTFSATTIAQADY
GMESAVEDLNREGARIVRRALDRATALDGRPRFVAGAVGPTNRTASISPDVNDPGYRAVS
FDDLRMAYGTQVRALIAGGADLILIETIFDTLNAKAAIFACFEAFAEAGRRLPLMISGTI
TDASGRTLSGQTPTAFWHSVRHARPFTVGLNCALGAAAMRPHLAELAGVADAAICAYPNA
GLPNAFGQYDEGPDETAAQVARFAREGLVNVVGGCCGTTPDHVRAIACAVADLPPRTLV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccttcccgctatggtctccgcttctcctcctgatccgaccggactccatgctg
accttttcccttccgccctcccgcgccgttccggctctcgaggccctcgtgcgccaacgc
atcctgatcctcgacggggcgatgggcacccagatccaggcgctcgggctgagcgaggag
gattatgccggctgcggctgccgccaccacgccgagcggccgcagaagggcaacaacgac
ctcctgatcctgacccagccgcaggccatcgaggagatccatttccgctatgccatggcg
ggtgccgacattgtcgagaccaacaccttctcggccaccaccatcgcgcaggccgattac
gggatggagagcgcggtcgaggatctgaaccgcgagggggcgcggatcgtgcggcgcgcg
ctcgatcgggcgacggcgctcgacgggcggccgcgcttcgtggcgggcgcggtggggccc
accaaccgcaccgcctcgatcagccccgacgtcaacgatccgggctaccgcgctgtgagc
ttcgacgatctgcgcatggcctacggcacgcaggtgcgggcgctgatcgcgggcggcgcg
gatctcatcctgatcgagacgatcttcgacacgctgaatgcgaaggccgcgatcttcgcc
tgtttcgaggccttcgccgaggccggccgccggctgccgctgatgatctcgggcacgatc
accgacgcgtcgggccgcacgctctcgggccagacgccgaccgccttctggcattcggtg
cgccatgcgcggcccttcacggtggggctgaactgtgcgctcggagccgcggccatgcgg
ccccatctggccgagcttgcgggtgtggccgatgccgcgatctgcgcctatccgaacgcg
ggcctgcccaacgccttcggccagtatgacgagggcccggacgagacggcggcgcaggtc
gcccgcttcgcccgcgaagggctcgtcaatgtcgtgggcggctgctgcggcaccacgccc
gaccatgtccgcgccatcgcctgcgcggtggccgatcttccgccaaggaccctcgtatga

DBGET integrated database retrieval system