KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3353Help
Entry
RSP_3353          CDS       T00284                                 

Definition
(RefSeq) Phage related tail protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_TAC_7
Motif
Other DBs
NCBI-GeneID: 3722055
NCBI-ProteinID: YP_354859
UniProt: Q3IWX6
Position
2:419176..419472
Genome map
AA seq 98 aa AA seqDB search
MSKTTLLQPLKRASGDIASVTVRKPDVGSLRGLKLTDILQMDVTALSRLLPRITEPALLP
DEVAALDPADFLGLSAAVVGFFATAEMVATAEADLLRH
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaaccactcttctccagccgctgaagcgagcctcgggcgacatcgcgagcgtc
acggtgcgcaagcctgacgtcggcagtctgcgcggcctgaagctcaccgacatcctgcag
atggacgtgaccgcgctcagccggctgctgccgcgcatcaccgagcccgcgcttctgccc
gacgaggtggcagcgctcgatccggccgacttcctcggcctctccgcggcggtcgtgggt
ttttttgcgacggcggagatggtggccacggcggaggcggatcttctccgccactag

DBGET integrated database retrieval system