KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3358Help
Entry
RSP_3358          CDS       T00284                                 

Gene name
gpX
Definition
(RefSeq) Phage tail component protein X
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_tail_X
Motif
Other DBs
NCBI-GeneID: 3722058
NCBI-ProteinID: YP_354862
UniProt: Q3IWX3
Position
2:422364..422576
Genome map
AA seq 70 aa AA seqDB search
MSRIYRTLAGDMLDAICKARLGSERHVPAVLAANPHLAALGSVYPAGVLITLPEVAEPVA
TGQIRLWGRT
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgagccggatctaccgcaccctcgccggcgacatgctggatgcgatctgcaaggcccgg
ctcgggtccgagcggcatgtaccggcggtgctggcggccaatccgcacctggcggcgctc
ggctcggtctatccggccggcgtgctgatcaccctgcccgaggtggccgagccggtggcc
accggccagatcaggctctggggccggacatga

DBGET integrated database retrieval system