KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3366Help
Entry
RSP_3366          CDS       T00284                                 

Definition
(RefSeq) D-isomer specific 2-hydroxyacid dehydrogenase
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00030  Pentose phosphate pathway
rsp00260  Glycine, serine and threonine metabolism
rsp00620  Pyruvate metabolism
rsp00630  Glyoxylate and dicarboxylate metabolism
rsp01100  Metabolic pathways
rsp01110  Biosynthesis of secondary metabolites
rsp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RSP_3366
   00620 Pyruvate metabolism
    RSP_3366
   00630 Glyoxylate and dicarboxylate metabolism
    RSP_3366
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSP_3366
Enzymes [BR:rsp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     RSP_3366
    1.1.1.81  hydroxypyruvate reductase
     RSP_3366
    1.1.1.215  gluconate 2-dehydrogenase
     RSP_3366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 Gp_dh_N F420_oxidored AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 3722066
NCBI-ProteinID: YP_354870
UniProt: Q3IWW5
Position
2:429188..430135
Genome map
AA seq 315 aa AA seqDB search
MRLLITRPLPDRILEAARARFEVTVRNSTKPLSPEELRRALAEHDAVLPTLGDLFRAEVF
ADVPQPRARILANFGVGTNHIDVAAATAAGIAVTNTPGAVTDATADIALTLMLMTARRAG
EGERLVRRGAWEGWHPTQMLGLHMTGKRLGILGMGRIGKAIARRAHHGFGMEITFFNRSP
VADPGVPARQVGLAEALDADIVVVAVPATPATHHLVDAAALSQMRPGAILVNIARGDIVD
ETALIAALAEGRLAGAGLDVYEFEPEVPAALRAMENVTLLPHLGTAALEVREGMGLMAVE
NLLAFADGRPLPNAV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
ttgagactgctcatcacccgccccctgcccgaccggattctcgaggccgcccgcgcccgg
ttcgaggtcacggttcgcaacagcaccaagccgctctcgcccgaggagctgcgccgcgcg
ctggccgagcacgatgccgtgctgccgacgctgggcgatctcttccgcgccgaggtcttc
gccgacgtgccgcagccgcgcgcccggatcctcgccaacttcggcgtggggacgaaccat
atcgacgtggccgccgcgaccgccgccgggatcgccgtcaccaacacgccgggcgccgtc
accgacgccaccgccgacatcgcgctcacgctaatgctgatgacggcgcgccgggccggc
gaaggcgagcggctggtgcgccgcggcgcgtgggagggctggcatccgacgcagatgctc
ggtctccacatgacgggaaaacggctcggcatcctcggcatgggccggatcggcaaggcc
atcgcgcgccgcgcccaccacggcttcgggatggagatcaccttcttcaaccgctcgccc
gtcgccgatccgggcgtccccgcccgacaggtgggattggccgaggcgctggacgccgat
atcgtcgtggtggccgtgcccgcgacgcccgcgacccaccatctcgtcgatgcggcggcg
ctcagccagatgcggcccggcgcgatcctcgtcaacatcgcccgcggcgacatcgtcgac
gaaacggcgctgatcgcggcactcgccgaaggccggctcgccggcgcggggctcgacgtc
tacgagttcgagcccgaggtgcccgccgcgctccgcgcgatggagaatgtgaccctcctg
cctcatctggggaccgcggccctcgaggtgcgcgagggcatggggctcatggcggtcgag
aacctcctggccttcgccgacggccggccgctgccgaacgcggtctga

DBGET integrated database retrieval system