KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3375Help
Entry
RSP_3375          CDS       T00284                                 

Definition
(RefSeq) Membrane fusion protein, HlyD family
  KO
K02005  HlyD family secretion protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    RSP_3375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 HlyD DUF4131 Biotin_lipoyl
Motif
Other DBs
NCBI-GeneID: 3722077
NCBI-ProteinID: YP_354880
UniProt: Q3IWV5
Position
2:complement(439707..440984)
Genome map
AA seq 425 aa AA seqDB search
MAAGEGPMTDRSDDLARILDRRRRGRRWLWPLLALGLLAGGGLLWASRQGAEPALAYVTE
PVERGGLVVTVMATGTVQPTTQVEVSSELSGTLAAVEVDYNDEVAVGQPLARLDDTRLKA
QVANAEASLEAAEGRLEQARATALEAAENYRSRSALDQRGVAAHLDLVATEAAHKRAESE
VKIAEADRTLAAANLEVQRVDLAKAVIRSPIRGIVLDRAAEAGQIVASSLNTPVLFTLAE
DLTRMELRVDIDEADIGRVRVGNRASFKVDAYPGRSFKAEIVQVRYAPETTDGVVTYKAV
LSVDNGERLLRPGMTATATITVAEVEGALLVPNAALRFAPPAVAQPGSSGGNRGGGLLGL
IMPRAPGPMSEADATSGPTVWVLRDGEPDRVAVETGETDGRRTEIRGGALEEGAPVITDQ
REAGA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggccgccggagaaggacccatgaccgacaggagcgacgatctcgcccgcatcctcgac
cgacgccgccgcgggcggcgctggctctggcccctgctggcgctggggctgcttgcgggc
gggggcctcctctgggcctcgcggcagggggcggagcccgcgcttgcctatgtgaccgag
ccggtggagcggggcgggcttgtcgtgacggtgatggccacgggcacggtgcagcccacg
acgcaggtcgaggtttcctcggaactgtcgggcacgctcgccgcggtggaggtggattac
aacgacgaggtcgcggtgggccagccgctcgcccggctggacgacacgcggctgaaggcg
caggtcgccaatgccgaggcctcgctcgaggcggcggaggggcggctcgaacaggcccgc
gccaccgcgctcgaggcggccgagaactaccgctcgcgctcggcgctcgaccagcggggc
gtggccgcccatctcgatctcgtggcgaccgaggccgcccacaagcgcgcggaatccgag
gtaaagatcgccgaggccgaccgcacgctcgcggctgccaatctcgaggtgcagcgggtg
gatctggccaaggccgtgatccgctcgccgatccgcggcatcgtgctcgaccgggcagcg
gaggcggggcagatcgtggcctcctcgctgaacacgccggtgctgttcacgctggccgag
gatctgacccggatggagctgcgcgtcgacatcgacgaggccgacatcggccgggtgcgg
gtgggcaaccgcgcctccttcaaggtggacgcctatccggggcggagcttcaaggccgag
atcgtgcaggtgcgctacgcgcccgagacgaccgacggcgtggtgacctacaaggcggtg
ctgtcggtggacaatggcgagcggctgctgcggcccggtatgaccgcgaccgcgacgatc
acggtggccgaggtggagggcgcgctcctcgtgccgaatgccgcgctgcgcttcgccccg
ccggcggtggcccagcccggcagttccggcggcaaccgcgggggcgggctgctcgggctc
atcatgccccgcgcccccgggccgatgagcgaggcggacgccacgtcgggccccacggtc
tgggtcctgcgcgacggtgagcccgaccgggtggcggtcgagaccggcgagaccgacggg
cggcggaccgagatccgcggcggcgcgctcgaggagggggctccggtcatcaccgatcag
cgcgaggccggagcttga

DBGET integrated database retrieval system