KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3381Help
Entry
RSP_3381          CDS       T00284                                 

Definition
(RefSeq) NAD(P)H -dependent quinone oxidoreductase
  KO
K00344  NADPH2:quinone reductase [EC:1.6.5.5]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RSP_3381
Enzymes [BR:rsp01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.5  NADPH:quinone reductase
     RSP_3381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N
Motif
Other DBs
NCBI-GeneID: 3722083
NCBI-ProteinID: YP_354886
UniProt: Q3IWU9
Position
2:complement(444868..445842)
Genome map
AA seq 324 aa AA seqDB search
MTDHAIVATRPGGPDVLEWAERPAGRPGPGEVRLRQTAVGLNFIDCYFRSGLYPWPADEL
IPGGEAAGVVEELGEGVSGFAPGDRVAYTMPNGACRTARVLPADRLVRLPEGVTDEVAAS
IMLKGLTAQYLIHSSFRVEAGHHVLVHAAAGGVGQLLGQWLKAKGAITYGTVGGAAKAEM
ARASGFDHVIDYEATDFAEAVRELTGGRGCDVVYDSVGRTTWRGSLKSLRPRGSFVCFGQ
SSGPLDEFRFSDLAAGSFTANRPSLFHYIATRDELEARAADLFALVAEGRIVPRIGQTFA
LKDTAEAHRALEGRRTTGATVLLP
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcacgccatcgttgcgacccgccccggcggccccgacgtgctcgaatgggcc
gagcgccccgccgggcggcccggaccgggcgaggtgcgcctgcgccagacggccgtcggg
ctgaacttcatcgactgctacttccgctcgggcctctatccctggcccgccgatgagctg
atccccggcggcgaggccgcaggcgtggtcgaggagctgggcgaaggcgtgagcggcttc
gcgcccggcgacagggtggcctatacgatgccgaacggcgcctgccgcacggctcgggtc
ctgcccgccgaccggctggtccggctgcccgagggcgtgacggacgaggtggcggcctcg
atcatgctgaaggggctgacggcgcagtacctgatccattcgagtttccgggtggaggcg
gggcaccatgtcctcgtccatgccgcagcgggcggcgtgggacagcttctcggccagtgg
ctgaaggccaagggcgccatcacctacggaacggtcggcggcgcggccaaggccgagatg
gcgcgcgccagcggcttcgaccatgtgatcgattacgaggccaccgacttcgccgaggcg
gtgcgcgagctgaccggcgggcgcggctgcgatgtcgtctatgactcggtcggccgcacc
acctggcgcgggtcgctgaagagcctgcggccgcgcggcagcttcgtctgtttcggccag
tcctcgggcccgctcgacgagttccgcttctccgacctcgcggcgggcagcttcaccgcg
aaccggccctcgctcttccattacattgccacgcgcgacgagctcgaggcgcgggcggcc
gatctctttgcgctggtggccgaggggcggatcgtgccgcggatcgggcagaccttcgcg
ctgaaggacacggccgaggcgcaccgcgcgctggagggtcgccgcaccaccggggcgacc
gtgcttctgccctga

DBGET integrated database retrieval system