KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3406Help
Entry
RSP_3406          CDS       T00284                                 

Gene name
pdxA
Definition
(RefSeq) 4-hydroxythreonine-4-phosphate dehydrogenase PdxA
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RSP_3406 (pdxA)
Enzymes [BR:rsp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     RSP_3406 (pdxA)
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     RSP_3406 (pdxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-GeneID: 3721691
NCBI-ProteinID: YP_354911
UniProt: Q3IWS4
Position
2:complement(472232..473218)
Genome map
AA seq 328 aa AA seqDB search
MSSSPQPIVITMGDPSGVGAEVTVKALADLTPARRRAYAVIGDRETLLRARAACGLDLAL
HEFGDGAPEGSVAVIHEEVAGLPGRFGVLSPACGEASFRYIDRAVTMTRGGEAACIVTAP
INKEALNAAGHHYDGHTGMLAHLTGCAASWMLLASPTLNVIHVSTHISLKEAIGRATPER
VLETIRTGHRHLQRMGIAQPRIAVAGINPHCGENGLFGREDDLQVQPAVEAARAEGIDVV
GPIPADTVYYRAHSGAFDLVVAQYHDQGHIPIKLIAFDTAVNCSLGLPIDRCSVDHGTAF
DIAGTGRANHVNMLAALAYADKLVAGRG
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtccagttccccccaacccatcgtcatcacgatgggcgatccgtccggggtcggcgcc
gaagtgacggtgaaggcgctcgccgacctcacccccgcaaggcgccgcgcctatgcggtg
atcggcgaccgtgagacgcttctgcgcgcgcgcgccgcctgtggcctcgatctggcgctg
cacgagttcggcgacggggcccccgagggctcggtcgccgtgatccacgaggaggtggcc
ggcctgccgggccgcttcggggtgctctcgcccgcctgcggcgaggcctcgttccgctac
atcgaccgcgccgtcaccatgacgcgcggcggcgaggccgcctgcatcgtcacggcaccg
atcaacaaggaggcgctgaacgcggccggccaccattacgacggccacaccgggatgctc
gcccacctcacgggctgcgccgcctcgtggatgctgctcgcctcgcccacgctgaacgtg
atccatgtctcgacccacatctcgctgaaggaggccatcggccgggccacgcccgagcgg
gtgctcgaaaccatccgcaccgggcaccggcacctgcagcgcatggggatcgcgcagccg
cggatcgcggtggcggggatcaacccgcactgcggcgagaacgggctcttcggacgcgag
gacgatctgcaggtgcagccggcggtcgaggccgcgcgggccgagggcatcgacgtggtg
ggtccgatcccggccgatacggtctattaccgcgcccattccggtgccttcgacctcgtg
gtggcgcagtatcacgatcagggccacatcccgatcaagctcatcgctttcgacacggcg
gtcaactgctcgctggggttgcccatcgaccgctgctcggtcgatcacggcaccgccttc
gacatcgcaggcaccgggcgggccaatcacgtcaacatgctggcggcgctggcctacgcg
gacaagctggtcgcgggccgcggctga

DBGET integrated database retrieval system