KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3477
Entry
RSP_3477          CDS       T00284                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rsp02044]
    RSP_3477
Secretion system [BR:rsp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RSP_3477
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABA81080
UniProt: Q3IWK4
Position
2:547516..548046
AA seq 176 aa
MSESKAKVIERNRAPRVQIAYDVEHYGSPTTIELPFVMGVMADLAGKSETREAQKPAAER
AFVEVDAGRFGKFMEALSPRVKARVPNRLPGGAEGGEEEMFVDLSFRSMGDFAPDRMAEQ
VPALAELLRMRRQLEELLGYMDGKVSAEKRIAQLLTNEPLLAQVAGEAVKSRQPEE
NT seq 531 nt   +upstreamnt  +downstreamnt
atgagcgagagcaaggcgaaggtgatcgaacgcaaccgcgctccgcgggtgcagatcgcc
tatgacgtggagcattacggcagcccgacgaccatcgagctgcccttcgtgatgggggtc
atggccgacctcgccggcaagtccgagacgcgcgaggcgcagaaacccgcggccgagcgg
gccttcgtcgaggtggatgccggccggttcggcaagttcatggaggcgctgagcccgcgg
gtgaaggcacgggtcccgaaccggctgcccggcggggcggagggcggcgaggaggagatg
ttcgtcgatctcagcttccgcagcatgggcgatttcgcccccgaccgcatggccgagcag
gtgccggcgctggccgagctcctgcggatgcggcgccagctcgaagagcttctcggctac
atggacggcaaggtcagtgccgagaagcgcatcgcccagcttctgacgaacgagccgctg
ctcgcgcaggtcgcgggcgaggccgtgaagtcgcgtcagccggaggaatga

DBGET integrated database retrieval system