KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3481Help
Entry
RSP_3481          CDS       T00284                                 

Definition
(RefSeq) type VI secretion protein, VC_A0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rsp02044]
    RSP_3481
Secretion system [BR:rsp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RSP_3481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-GeneID: 3721897
NCBI-ProteinID: YP_354985
UniProt: Q3IWK0
Position
2:550843..552708
Genome map
AA seq 621 aa AA seqDB search
MDRAFLAYYEAELAELREAAAAFGTLHPTVGRNLSLDTVPCPDPYVERLLEGVAWLAART
RLKLDAEAQRSVRNLLDWLWPDLAGPAPAMALATLHPGPQVLGMADGHTVRRGTRLVAAF
REGLATRATYTTAQDVTLWPVTLEAAGYLPDRGALKAAGLSEAMAGGAEAAIRLALARAG
PGTLSELSLDRLDLCFAGSPRAPALFDAIHGTCRRAAARGAADFERVPAPALVGIDGAEG
LLPRLRPSFEGYRLIREYFLMPDRFHYLRLDGLQTAIRAATGRVEILLLLDRPRPALADV
AASDFRLFVTPVVNLFEKECNAVEVDPRSAAHVVHPDRTRPRDFEILRLLRVEDADSSGP
EAVIEPLHAPAAQGGLGLFYTTERRPRRPGEDELRRGQTRTSHAGDDLYISLVRRPGATA
PAVRRLDIRALCTNRDLPILDDSPRLTLESGDPVARVELLSALRRPRPALAAGLPRMTRE
AEAQQDEVIWRLAAQLSLDHLSLAETTDDAEPLRALLALYADRGDPAVARHARSIARVRA
RAVTERLDLPGPLCFGRGQEVTLEVDETVLSGASTLLLSALLAQLFARQAAINAVVRLRT
RLVQAQEEVTWPTIPGIRPPI
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcgccttcctcgcctattacgaggcagagctcgccgagctgcgcgaggcggcg
gccgcgttcggcaccctgcatccgacggtggggcgcaacctctcgctcgatacggtgccc
tgcccggacccctatgtggaacggctgctcgaaggggtggcctggctcgcggcaaggacc
cggctcaagctcgacgccgaggcgcagcgcagcgtgcgcaacctgctcgactggctctgg
cccgatctcgccgggcctgcgccggccatggcgctcgccacccttcacccggggccgcag
gtgctggggatggcggacggccacacggtgaggcgcggcacccgcctcgtcgcggccttc
cgcgaggggctggccacgcgcgccacctacacgaccgcgcaggacgtgaccctctggccg
gtgaccctcgaggcggcgggatacctgcccgaccgcggcgccttgaaggccgcggggctc
tccgaggcgatggcggggggcgccgaggcggccatccgcctcgccctcgcgcgcgcaggg
ccgggcacgctctccgagctgtcgctcgaccggctcgacctctgtttcgcgggcagtccg
cgcgcgcccgcgctgttcgacgcgatccacggcacctgtcggcgggcggcggcccgcggc
gcggcggatttcgagcgggtgccggcccccgccctcgtcggcatcgacggggcggaggga
ctgctgccgcgcctgcgcccctccttcgagggctaccggctgatccgcgaatatttcctg
atgccggatcggttccactacctgcgcctcgacgggctgcagacagccatccgcgcggcg
acgggacgggtcgagatcctgttgctcctcgaccgtccgcggccggcgctggcggacgtc
gcggcgtcggacttccggctgttcgtgacgcccgtggtcaatctcttcgagaaggaatgc
aatgcggtcgaggtcgatccccgctcggccgcgcatgtcgtgcacccggaccgcacaagg
ccgcgcgacttcgagatcctgcgcctgctgcgggtcgaggatgccgacagctccggcccc
gaggcggtgatcgagcccctgcatgcgcccgcggcccaggggggcttgggtcttttctat
accaccgagcgccgcccccgccgccccggcgaggacgagctgcgccgggggcagacccgg
acgagccacgcgggcgacgatctttacatctcgctcgtgcggcgtccgggcgcgacggcg
cctgccgtccggcggctcgacatccgcgcgctctgcaccaaccgcgacctgccgatcctc
gacgacagcccgcgcctcacgctcgaaagcggcgatccggtggcgcgggtcgagcttctg
tcggcgctccgccgcccccgtcccgcgctggccgccgggctgccgcgcatgacccgcgaa
gcggaggcgcagcaggacgaggtcatctggcgcctcgccgcgcagctctcgctcgatcat
ctgtcgctcgccgagacgaccgacgacgccgaaccgctgcgcgcgctgctcgcgctctat
gccgaccgcggcgacccggccgtggcccgccatgcgcggtccatcgcccgggtgcgggcg
cgcgccgtgaccgagcggctggatctgcccggcccgctctgcttcggccgcggacaggag
gtgacgctcgaagtcgacgagacggtgctgagcggggcgagcacgcttcttctgtccgcg
ctgctcgcgcagctcttcgcgcggcaggcggcgatcaacgcggtcgtccggctgcgcacg
cggctggttcaggcacaggaggaggtgacatggccgacgatccccggcatccgccccccg
atctga

DBGET integrated database retrieval system