KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3743Help
Entry
RSP_3743          CDS       T00284                                 

Gene name
speB1
Definition
(RefSeq) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00330  Arginine and proline metabolism
rsp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RSP_3743 (speB1)
Enzymes [BR:rsp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     RSP_3743 (speB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-GeneID: 3721502
NCBI-ProteinID: YP_355250
UniProt: Q3IVT5
Position
2:complement(868722..869684)
Genome map
AA seq 320 aa AA seqDB search
MSVLPTDSLSTPRFVGLPSFMRLPMATELQGLDAAIVGLPSDSGAPFRTGARFAPNALRA
MSVMLRPINPYRGHINIFEVLRVADAGDATCVPGYEIESLAALERALDAVVEAGAVPFGI
GGDHSVSLAGLRAVAKRHGPLGLVHFDSHTDTWDSYFDGKRYSAGTMFRRAIEEGIVDPA
RSIQVGMRGSLFQPADVSQSVDLGLEVITCDEMFALGLPETARRIAARSAGHPAFLSFDL
DFVDPAYAPGVETPECGGPTARETLSLLRSLQGLNLVGCDVVELNPSYDGPGQITALLGA
TVMAELLAILAEARVRERSR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcctgcccaccgattcgctctccaccccccgcttcgtcggcctgccgagcttc
atgcgcctgcccatggccacggagcttcaggggctcgacgccgccatcgtcggcctgccc
tcggattcgggcgcgcccttccgcaccggcgcgcgcttcgcgccgaacgcgctgcgcgcc
atgtcggtgatgctgcgcccgatcaacccctaccgcggccacatcaacatcttcgaggtc
ctgcgcgtggccgatgcgggcgacgcgacctgcgtgccgggctacgagatcgagagcctc
gccgcgctcgaacgggcgctcgacgcggtggtcgaggccggcgccgtgcccttcggcatc
gggggcgaccactcggtctcgctcgccggtctccgggcggtggccaagcgtcacgggccg
ctcggcctcgtgcatttcgacagccacaccgacacctgggacagctacttcgacggcaag
cgctacagcgccggcaccatgttccgccgggccatcgaggagggcatcgtcgatcccgcc
cgctcgatccaggtggggatgcgcggctcgctgttccagccggccgatgtcagccagtcg
gtcgatctcggcctcgaggtcatcacctgcgacgagatgttcgcgctgggactgcccgag
accgcccgccggatcgccgcgcgcagcgcaggtcacccggccttcctgagcttcgatctc
gatttcgtggatcccgcctatgcgcccggcgtcgagacgcccgagtgcggcggccccacc
gcgcgcgagacgctctcgctgctgcgcagcctccagggcctcaacctcgtcggctgcgac
gtggtcgagctcaatccttcctatgacggtccgggccagatcaccgccctgctcggggcc
accgtcatggccgagcttctggcgatcctcgccgaggcgcgggtccgcgagcggtcacga
taa

DBGET integrated database retrieval system